CAZyme Information: MGYG000001056_01894

Basic Information

• Species: Prevotella sp900556395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556395
• CAZyme ID: MGYG000001056_01894
• CAZy Family: GH99
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		68963.55	6.4401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001056	3020119	MAG	Spain	Europe

• Gene Location: Start: 21546; End: 23351 Strand: +

Full Sequence      

MIRNLLVILLVNLLSLSAAYAGNGKKVYADYHGVRYTRQHDGQIGRWGMFATMPKTSTDI
KYICRNADIIGDDGRHEIAAKHYPMVGMQSNLDPDFIEYQILTAKAAGIDGFFIEWGFMP
HENDNLLKAMQPIAAKYGFEIGVNWCDGWLYYDWITRIYPNIKTRADKTKYMEKCFKYLA
DSVFTGKTAPIVNGRPVFYHFGGGATPEEFAQVLEANKDFVSKTNPVMLRRWADWGKLEN
NIYKPVTYSAKMEEWKKLKEVPTAWIPARVRERDAEHLGCDFWASKEDVLRFMEPFRDQV
WLSNNPDYTVKCGFVIPGMDNHGCGGWGHSKFYEIDRYKGKLYDAMWQYNMQYRDSLDMM
FIASWSDYTEGHEIEPTIENGYRELETTLRYASVFKEFEPNISALRLPQQLFQMRKAVEL
LNLIGLKEDLLTQLLDNAALQMAEGSYQQAADLMIQASEMIGQENEKVTNNEFTLTTSAL
TIKGGESTKGCWDATEGFSVTLPTQASVNLNALYNRGIIDFWYLDKGTETLFVRSTTNRQ
PKSYFAVVGKVATCDTGEWKHARIELYGENITYSFGKPTFFFKGNVKVRDISLKFNSFSI
Q

Enzyme Prediction     

No EC number prediction in MGYG000001056_01894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH99	40	387	1.5e-25	0.9041916167664671

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11575	GH99_GH71_like_3	6.11e-111	23	450	5	376	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11573	GH99_GH71_like	2.25e-14	93	412	9	284	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11574	GH99	9.99e-08	73	392	37	322	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.
cd11578	GH99_GH71_like_1	1.18e-04	84	390	23	306	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT51249.1	8.59e-105	22	460	150	592
QEG20573.1	4.69e-20	45	467	57	421
AWG21571.1	9.63e-20	23	416	62	396
QSW88512.1	4.57e-19	23	394	46	361
ABQ07335.1	2.02e-17	23	394	46	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.999112	0.000153	0.000158	0.000147	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001056_01894.