CAZyme Information: MGYG000001057_00066

Basic Information

• Species: Negativibacillus sp000435195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Negativibacillus; Negativibacillus sp000435195
• CAZyme ID: MGYG000001057_00066
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000001057_2|CGC1	66068.53	5.4891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001057	2192208	MAG	Spain	Europe

• Gene Location: Start: 58684; End: 60432 Strand: +

Full Sequence      

MSRLCYQGEQFLLDQKPFRFLSGTIHYFRVTPDYWEDRLKKLRACGFNAVETYTCWNLHE
RQEGRFDFSGGLDVARFVQTAQKLGLYVILRPGPYICAEMDFGGLPSWLLNRPGLALRCN
NPLFLQKVAAYYKQLFDRLRPYLGENGGNIIAVQVENEYGSYGNDKDYLRAVVQIYRDNG
VNEFFFTSDGPNQLMLGGGSLPEYLATANFGSRGKEHFDTLRRFAPERPVMCTEFWNGWF
DHWYEQHHRRESDETAGQLEQMLRDGGSVNLYMFHGGSNFGFTNGANHDGCYQPTVTSYD
YDCPVSECGDLTEKYFAIKRVAEQYMGKAPDLQVGNLPKHDYGRVQLTQQTPLFAHLPQP
VESASTLTMEQLEQDFGFVLYETVLHGPFERSELTIDGLHDRALIYVDGKLAGIQERTGR
RNDAIYLELEAGQTAVLRILVENMGRINYGPKLLDCKGILRGVKLGCQYQFGWKHYSLPC
DCPPQQGYEPVGAGADAPLFLKGSFTVQQRQDTFVRLDGFTKGNVYINGFHLGRYWNPAG
PQKTLYLPAPLLREGENELAVLELEGIDGPAQVHLTDCEDLG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	322	4.8e-118	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	2.53e-152	10	322	1	315	Glycosyl hydrolases family 35.
COG1874	GanA	5.19e-53	6	557	3	583	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	2.02e-47	6	309	32	325	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	2.22e-11	28	160	5	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam13364	BetaGal_dom4_5	0.006	491	562	44	104	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK60278.1	3.44e-215	1	582	1	583
QAV16979.1	1.83e-214	1	582	1	586
AFC31375.1	3.68e-214	7	582	7	582
AEI43760.1	3.68e-214	7	582	7	582
SDS86384.1	4.39e-214	1	571	1	573

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	1.04e-204	1	564	15	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	2.85e-158	9	576	8	582	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	1.61e-146	3	565	17	607	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	2.96e-141	1	565	8	599	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	6.00e-141	1	565	32	623	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	7.89e-150	6	565	35	621	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q8VC60	7.19e-146	7	577	31	615	Beta-galactosidase-1-like protein OS=Mus musculus OX=10090 GN=Glb1l PE=1 SV=1
P23780	5.89e-145	3	565	34	624	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q9TRY9	8.78e-144	6	570	37	632	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
O19015	3.60e-143	3	565	34	624	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001057_00066.