CAZyme Information: MGYG000001058_00572

Basic Information

• Species: UBA6398 sp900550635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900550635
• CAZyme ID: MGYG000001058_00572
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		59655.38	7.7884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001058	2245359	MAG	Spain	Europe

• Gene Location: Start: 14186; End: 15787 Strand: -

Full Sequence      

MKQIKRIIFAACALVLSAGLSGLKAQGTLSDGSKWHWEKGTIVIDTPARPAGQEHALNLA
TPKLKVVRVGFVGLGMRGPGAVERWTHIPGVQIVALCDHEKERAENCQKILTKAGMPEAA
IYYGDSGYVELCKRPDIDIVYIATDWLHHFPVAYCALENDKHAAIEVPSAMNLKECWALI
NISEKKRKHCMLLENCCYDWFEMNTLNMAQQGVFGEILHVSGAYCHDLDPFWDYYWKKDA
NDKLGWRLEYNMKHRGDVYATHGLGPVAQLLNIHRGDRMKTLVAMDTKSVHGVQLVEERT
GQKVDFRNGDFTSTMIRTENGKMIRIDHDVMNPQPYDRKYQLVGTKGFANKYPVEGYALG
SEDMKKAGVTPSADNLSGHEYMSDKDKQALINKYYNPILKKYGDNAKEVGGHGGMDFIMD
ARLVYCLQNGLPLDIDVYDLAEWCCLAELGALSMDNNNASVQVPDFTRGHWNDIKAYKHA
FASPEDEAAAAQAAKYFTDGMKAGGQKFIEKYWKDEAKAAKKAAKAAKKAKKI

Enzyme Prediction     

No EC number prediction in MGYG000001058_00572.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	472	1.8e-155	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.78e-22	65	357	2	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.11e-10	67	191	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	0.005	110	188	24	116	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24012.1	1.32e-281	1	507	1	509
ALJ58162.1	1.37e-281	1	505	17	522
QUT90820.1	1.59e-280	1	505	17	522
QUT75090.1	4.04e-273	1	505	1	505
ADY37128.1	1.83e-272	1	507	1	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.96e-84	49	471	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.56e-69	65	486	19	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	8.01e-11	56	224	2	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	9.95e-271	1	517	1	514	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	1.64e-270	1	521	1	519	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	2.17e-220	3	502	2	498	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	3.40e-209	19	482	11	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	2.12e-206	9	482	9	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000708	0.793911	0.204584	0.000295	0.000247	0.000210

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001058_00572.