CAZyme Information: MGYG000001058_01025

Basic Information

• Species: UBA6398 sp900550635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900550635
• CAZyme ID: MGYG000001058_01025
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	MGYG000001058_164|CGC1	65222.56	10.2569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001058	2245359	MAG	Spain	Europe

• Gene Location: Start: 15266; End: 16963 Strand: +

Full Sequence      

MSDIFQIMSDIFFTASNRTPRDTDKNRKAGHAGPHKTAPPGKTTNIPPPPKLRRKQARHK
LNDMGTTYTPTQAIANRRRHIMLAVFCIIAFFANNTALRPDIMETRNLQTAREMVEGDHW
LVPMMNGNYRLEKPPLPTWIAAVVDAVSPDNLAAQRAMSGLAGCMMVVFFYLLGKRVTRR
DDYAFIASLMLITCYNIILMARTATWDIYCHAFMLGGIYYLTRGLYEERRIWRHMLLAGT
FMGLSFMSKGPVSFYALLLPWIIAVVLFRRPTMRGRIAPLMAMIAVCLVLSSWWYVYILI
THSEAANYVINKESDSWRNRSVRPWYYYWRFFTETGVWTPLMFIALAIPFWRRKLAASKH
NYTFAMAWVLAALVLLSLMPEKKMRYLLPMMIPCCFAMAYLIIYWNDKRGKPTARNVVLV
VAAVFAAAELFAMPFIARQFYNPDYNSISQTYGDPRLKDVPFYYNKANPLRIEVVYASHR
IIRPLEFSSPHIADTLAAKLPCALVTRETADKELPAEVFNRFDTVYIGKFNDSNRSRFAN
YGKDASFIYNVTLLKPKKNDRQQDR

Enzyme Prediction     

No EC number prediction in MGYG000001058_01025.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	74	436	4.1e-68	0.6648148148148149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.69e-28	75	404	3	336	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	4.43e-15	133	295	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	1.92e-09	100	265	31	193	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	1.36e-06	98	294	26	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG5617	COG5617	6.54e-05	134	351	71	289	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA66128.1	7.64e-21	104	389	46	343
QEG37267.1	4.79e-19	81	391	273	587
ADR19199.1	8.30e-19	83	443	12	365
ANA39794.1	6.34e-18	76	443	4	360
AEI13959.1	8.40e-18	101	446	31	365

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48HY9	1.17e-16	100	425	31	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1
O67270	5.55e-15	78	389	3	308	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A1JPM4	3.14e-12	81	415	11	344	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q7N3Q9	4.14e-12	82	443	13	380	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
A8FRR0	2.05e-10	100	443	32	380	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
81	98
152	174
183	205
251	268
275	297
329	351
364	381
386	405
417	436