CAZyme Information: MGYG000001058_01435

Basic Information

• Species: UBA6398 sp900550635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900550635
• CAZyme ID: MGYG000001058_01435
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		66956.56	6.5692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001058	2245359	MAG	Spain	Europe

• Gene Location: Start: 3526; End: 5328 Strand: -

Full Sequence      

MKLLKTLCLAASAALAIPMTAQEKAQAVNGIPVEAPVNVVPAWGNEPLETDSRVVSYILP
KRIMWTQSTWNAKIENQDVLLKNNYGQAALAGVELCHINNAGDGTNSLLFDFGREINGGI
QIVTGMSATKTAKIRVRFGESAEEAMCDIDNKNGATNDHAIRDFTIELPWLGITECGNSG
FRFVRIDVLGDDTDILLQEVRAAFKRRDIPYLGSFECSDKRLNDIWMTGAYTVHLNMQQY
LWDGIKRDRLVWTGDINPEIHTVATVFGYNDVVDKSLDLSKQLFKPNQWMCGLSSYSVWW
LISHYDWYIYTGNRKYLDEQQTYIEQLLDVLLSKVNEQGYETLDARFLDWPSSTNEKGID
AGLQAIMAMAMDCGAKMATLWGNEALAQKCSQTAEKMKKCRRDFNGSKQAASLNAIAGMI
DPAQAANETILPGGAKGFSTFYGYYMLEALALAGKYTEAMDIMSQYWGAMLDLGATTFWE
DFDIDWTKNAARIDELVPKGKVDVHKTYGDYCYKGYRHSFCHGWASGPTTWLSRHVLGVK
VLEPGCKKVAIEPHLGNLKWAKGTFPTPYGVIEISHEVNEKGKVISKVKAPKGVKIVKNK

Enzyme Prediction     

No EC number prediction in MGYG000001058_01435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	106	595	5e-103	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.94e-16	213	536	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.30e-07	538	595	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG54529.1	3.70e-234	39	598	23	583
QUT95156.1	5.25e-234	49	596	21	580
AST53793.1	5.25e-234	49	596	21	580
QJE27358.1	2.91e-233	49	596	21	580
QUR50485.1	2.91e-233	49	596	21	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.59e-49	108	593	194	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	7.26e-11	106	537	93	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	3.83e-07	109	580	365	879	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000328	0.998903	0.000212	0.000219	0.000178	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001058_01435.