CAZyme Information: MGYG000001058_01699

Basic Information

• Species: UBA6398 sp900550635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900550635
• CAZyme ID: MGYG000001058_01699
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		70752.29	6.3012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001058	2245359	MAG	Spain	Europe

• Gene Location: Start: 4076; End: 5974 Strand: -

Full Sequence      

MKTKYFYSTLLCCAAFAATAAANAANGTTEDRLAASLLKSKTPCVVNIKFGGHVGQDIND
CFTHRVLGENTEELVEPFRHKEATNTWQTEFWGKWMLGAVDMYRYTHSRELYDKMKVSVD
EIIATQQPDGYIGNYAPEHRLKEWDVWGRKYVVRGLLAWYDISGDKDALKAARKETDCLI
EELKEKNKKIVETGNYRGMASASILNAVVKLYQATDDEKYLDYAKQIVDDIESPQGPQLI
KKALAGNPVAERFPYPASWYSYENGHKAYEMMSCYEGMLDLYKITGDENLFKAAKMAVDN
IVDTEINIAGSGSAHECWYGGKALQTRPTFHTMETCVTTTWLQILNRLRAMTGESRYSDL
MEQTIYNALAASLKSDASRIAKYMPLEGVHTPGEQQCGMTTNCCNANGPRGFALVSQTAY
TVKPSEITANFYVPSTATINIGNKKCVTLEQTGDYPKDDVVEIKVTSEKAEDFALKLRIP
SWSNATAVSVNGTAVDGVRPGTFLAINRTWKSGDVVNIRFDMNPRAVQQDNCEALMWGPV
VLARDSRFNDGFVDEAVTVSRKDGRVELKPAEAPEWAWICFKAPMVVGLDEIDHGKPRDV
LFCDFGSAGNTWSPKERYRVWLPKALDVHKKQ

Enzyme Prediction     

No EC number prediction in MGYG000001058_01699.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	83	541	2.3e-66	0.9045801526717557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.60e-70	93	543	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.43e-51	87	552	58	509	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	2.58e-04	151	255	472	576	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	4.24e-04	155	301	600	742	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam06662	C5-epim_C	4.93e-04	184	363	14	185	D-glucuronyl C5-epimerase C-terminus. This family represents the C-terminus of D-glucuronyl C5-epimerase (EC:5.1.3.-). Glucuronyl C5-epimerases catalyze the conversion of D-glucuronic acid (GlcUA) to L-iduronic acid (IdceA) units during the biosynthesis of glycosaminoglycans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.42e-185	45	628	24	612
QHS51661.1	5.43e-39	94	611	123	645
SDR74932.1	1.58e-38	110	570	109	578
QPC85013.1	1.65e-37	76	541	60	558
QOY86860.1	2.24e-37	94	623	97	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.46e-38	114	549	90	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	1.22e-30	70	625	71	697	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	4.07e-25	60	541	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.65e-22	60	541	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.10e-20	94	599	80	612	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.01e-20	94	599	80	612	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.999135	0.000160	0.000167	0.000139	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001058_01699.