CAZyme Information: MGYG000001059_00745

Basic Information

• Species: Porphyromonas_A somerae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A somerae
• CAZyme ID: MGYG000001059_00745
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000001059_42|CGC1	58073.67	5.4852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001059	2193999	MAG	Spain	Europe

• Gene Location: Start: 20206; End: 21759 Strand: -

Full Sequence      

MMTKKGLLFATLLLFSTCLLSAQEGGIKVYPSRHGVEAGAQHKTLLAIELEEPLKRSDQL
QLRFAIPTESQRLIESLEILSSDSLAVRDLDDYKGRVKYATHPLNSWCEATLTGKAYEGA
KVLYLSANLATPEHYSPHHILRCRMKELSLNGQTVEAKQVGDETFRRFFRSYKPLFVPGD
GGSRNYRIPVIHKTQSGVLLAFADRRKFNQTDIPEDIDIIQRRSFDNGKTWSEPEILIRG
TGYGKGYGDVAIVQAKSGKLVMLFIGGQGLWHGRPDTPMPTYMMTSDDDGATWSPARDIT
HFIYGSECTDPQRSQFWSAFCASGQGAVTESGRIMFVTAIRPDANYRLDNYLVYSDDEGE
TWQVSERAYAGGDESKVIVMPDGAILMSIRNPHKGDRIFRVSYDEGKTWQPTQDYAGLHD
PACNGAPLLMEQNGLKMLLHSLPYGPNKRWDGALYGYDPYRQQWSDAVVINPGMSAYSDM
VDLGDGLIGYFVEEDDEMSMVFITFTLEDLQAMQREH

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	175	505	9.6e-71	0.9678362573099415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.22e-88	174	506	2	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.13e-15	216	489	17	279	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.52e-06	179	235	268	324	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
smart00602	VPS10	0.003	288	410	302	429	VPS10 domain.
cd00182	T-box	0.008	328	388	23	98	DNA-binding domain of the T-box transcription factor family. The T-box family is an ancient family of transcription factors which plays a multitude of diverse functions throughout development. The founding member of the family is Brachyury (also known as TBXT, or T). Members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns. The T-box factors in Caenorhabditis elegans have evolved very differently than those in other organisms; its genome contains 22 T-box genes which encode factors which are diverse in DNA-binding specificity, function and sequence, and only 3 of these factors fall into the conserved T-box subfamilies.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK25617.1	1.12e-176	20	510	4	497
AUR47485.1	2.53e-176	20	510	28	521
AIJ36381.1	4.71e-174	20	510	28	521
BAG34127.1	4.71e-174	20	510	28	521
AUR49244.1	4.71e-174	20	510	28	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	1.72e-27	175	493	14	344	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	1.54e-26	175	493	14	344	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	4.90e-26	175	493	10	340	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	8.79e-26	175	493	10	340	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	1.18e-25	175	493	10	340	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	9.73e-26	175	493	56	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P29767	7.93e-20	175	512	384	828	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P10481	8.40e-20	183	410	33	265	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	1.54e-17	186	425	54	295	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P31206	4.10e-17	179	409	196	434	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000338	0.998757	0.000337	0.000176	0.000181	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001059_00745.