CAZyme Information: MGYG000001059_01276

Basic Information

• Species: Porphyromonas_A somerae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A somerae
• CAZyme ID: MGYG000001059_01276
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001059_74|CGC2	42585.2	8.9294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001059	2193999	MAG	Spain	Europe

• Gene Location: Start: 30682; End: 31788 Strand: +

Full Sequence      

MNKQLIVISAVNINTGGTLEILNNCLEYLSTQVDHLRVIAIVHDKKLALYEGIEYIEIPW
AKKTWMHRLWCEHITLKKLSKRLSSIDLWLSLHDTTPNVVANKRAVYCHNAFPFYKGSIR
DLCLNYKIFFFAWLSKNFIYRPNIKKNDFVVVQTQWFKDAFEKLFSLSSERIIVFPPMMP
IRNDEIRPANNSRTTTFFYPAAPNVHKNFELLCQASKLLEEQIGKGRFQTILTLKGDENR
YAKYLYSRWGEVSSISFAGYQNQTQMRELYDKADALVFPSKVETWGLPITEFGRYGRPFL
LADLPYAHETAGGLLQTAYFSPHDANELANLMKKVIEEAYGSFMPTPITNPTPPIANTWA
KLFDELLQ

Enzyme Prediction     

No EC number prediction in MGYG000001059_01276.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.46e-51	5	339	3	334	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
COG0438	RfaB	1.42e-17	5	368	4	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	6.99e-17	37	337	33	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03823	GT4_ExpE7-like	1.58e-11	131	338	130	327	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03811	GT4_GT28_WabH-like	2.69e-10	76	309	75	299	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA26380.1	1.10e-125	3	368	2	368
CAY03604.1	3.99e-124	2	367	4	369
AAO75161.1	3.99e-124	2	367	4	369
QMW87127.1	3.99e-124	2	367	4	369
AKH95634.1	3.61e-121	3	368	2	368

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37751	2.91e-69	1	342	1	340	Putative glycosyltransferase WbbK OS=Escherichia coli (strain K12) OX=83333 GN=wbbK PE=4 SV=1
P26402	3.63e-06	93	335	98	319	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001059_01276.