CAZyme Information: MGYG000001060_00224

Basic Information

• Species: Dialister hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister hominis
• CAZyme ID: MGYG000001060_00224
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000001060_7|CGC1	64530.53	7.2512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001060	2084459	MAG	Spain	Europe

• Gene Location: Start: 2711; End: 4420 Strand: +

Full Sequence      

MSTKRQKKEKKEKARQEAFSTSHVTEKSLGFIFILAFAFLLWGSWALPITDPVESNYALT
AKEMVMSGNWMSPQIYGIYWYDKPIMVYWLLSISYSILGFTDLAARLPSAFCGALSVTLL
TWYVRRILKDNIAAIWAGLMLALSFEFWIISHAIITDSILLLFTIPTLLSAYIGVMEGSR
KHLIIAYAAAGFACLTKGPVGLVLPGILLVLWCLSMKEPKKILSLFPITGILAFLVVVLP
WYGGMYAIHGSDFVSQFLGLHNIARATVSEHPEDNHWYYYLVIFPAALLPWTGMTIYEAV
RQWKEKTPFYRFLMVWMIGTILFYTLMATKYVTYTYISIVPAIILSAMCALLVREGEKAS
SLCAYGGFFFLIAALVAGTIYIKEGSWLLFYAVILYAVWELILRWKKSSGRRLTVISAVT
ASAYLFIIMEGLPNYLPSRSIMDSANDIHDAPGIHYFFHSYPAGYTYYTGETGIRLVPSL
PDEEKRSALWNEKYVMPSESDEDFAKEYKDSGKSVYLFVSKSDMKYFKEWPMKDDFTKDK
DLPRGTLYHLNDEPEAAGETVPLSPAEEN

Enzyme Prediction     

No EC number prediction in MGYG000001060_00224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	25	405	3.6e-89	0.7388888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.25e-50	27	412	8	407	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.83e-34	25	402	3	398	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	6.65e-23	82	241	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.70e-14	54	249	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.58e-05	77	414	56	445	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	0.0	1	569	1	569
AOH39318.1	2.70e-179	26	548	9	534
QQB17174.1	1.42e-122	32	551	10	537
SNV02078.1	1.42e-122	32	551	10	537
ACZ25367.1	1.42e-122	32	551	10	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.59e-20	49	343	54	356	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	3.74e-31	48	444	24	430	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.24e-30	48	444	24	430	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B4TBG8	3.03e-26	33	359	7	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
B4ETL9	1.01e-25	29	334	14	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A1JPM4	1.36e-25	45	347	20	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999590	0.000386	0.000002	0.000000	0.000000	0.000017

TMHMM  Annotations     

start	end
28	50
76	98
103	122
132	154
159	176
186	215
222	244
278	300
307	326
331	353
360	382
386	403
415	432