CAZyme Information: MGYG000001060_00377

Basic Information

• Species: Dialister hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister hominis
• CAZyme ID: MGYG000001060_00377
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000001060_12|CGC1	33564.99	5.6187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001060	2084459	MAG	Spain	Europe

• Gene Location: Start: 19238; End: 20152 Strand: +

Full Sequence      

MKRLFMLIVLACAVYWGFSQGSGIEKYIPASLTGSAPKAASSAPSSAKKDDSLYGEVTDM
VSTFASGVTGTTDSGKVTVNKSKDAPNATVAKEQDIQTLRQEYHDLTNFKEALESRVHRE
NFVPFKDIPQYLIDGVVATEDRRFYDHGAMDPIGVARAMVTNYMAGETLEGGSTIDQQTV
KNIFLSPERTMSRKIEELALAVQLDRYYTKQEILELYLNTIYFGHGAYGLREASHTYFGK
EPKELDLSQCAMLAGLPQAPSAYDPIDHPKAGTERMTVVLTLMAQEGYITHEQAAHAAAN
LWLR

Enzyme Prediction     

No EC number prediction in MGYG000001060_00377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	118	283	2.6e-66	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	8.65e-87	115	284	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	9.84e-83	118	297	1	179	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.18e-80	118	294	75	251	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.45e-76	101	297	35	244	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.76e-55	123	293	69	239	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25656.1	3.77e-216	1	304	1	304
AOH38594.1	1.24e-86	97	302	63	268
AXL21687.1	5.06e-64	96	297	51	253
AXB81629.1	5.36e-61	108	297	59	249
AVO26612.1	1.21e-60	108	297	65	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	7.64e-56	117	297	17	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.53e-55	117	297	17	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	2.09e-44	113	293	31	213	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	4.64e-39	119	293	38	212	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.41e-38	119	293	26	200	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.98e-50	117	297	60	240	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	1.46e-46	123	297	70	244	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q07259	7.26e-46	111	290	38	216	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87626	8.07e-45	119	297	67	245	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	1.54e-44	108	293	83	269	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.065879	0.518946	0.414405	0.000253	0.000226	0.000268

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001060_00377.