CAZyme Information: MGYG000001060_01273

Basic Information

• Species: Dialister hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister hominis
• CAZyme ID: MGYG000001060_01273
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		37670.53	8.333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001060	2084459	MAG	Spain	Europe

• Gene Location: Start: 2541; End: 3524 Strand: +

Full Sequence      

MENVLLHAVKDTVFIGGEPEKDAFHIALTGTADYIPHMGVVALTVREHNKDLPLCFHFFV
NQLVDEEKKHLEEMALITGCPVQVHLIDDRAFKTLLLSDGNPAFFYRFLVAPTLAPLTDR
GLYLDGDMMCRGSLRYLKELDFGDKIVAVVSDRNEKAQMKRMHTSRYFNAGMMLMNLGPW
MEQGCFDDIVRRAQENVKRVGNRLSHHDQDIHNEMLDGKCLYIEKKYNYLYNLDRQSLFK
KQPVNEDYKNQVIIHFAGHAKPWHSWVQGWPVVKEYAAIQKSSPWKDVPLVPPKGTKNLH
QAARTARMNGQYGAMIGWYLKYFAAKL

Enzyme Prediction     

No EC number prediction in MGYG000001060_01273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	21	266	1.2e-42	0.8910505836575876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	2.76e-57	24	265	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
PRK15171	PRK15171	1.54e-52	20	327	22	333	lipopolysaccharide 3-alpha-galactosyltransferase.
pfam01501	Glyco_transf_8	8.45e-46	25	266	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	4.51e-43	24	290	3	271	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam08437	Glyco_transf_8C	2.95e-19	271	323	1	53	Glycosyl transferase family 8 C-terminal. This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25792.1	3.37e-251	1	327	1	327
BBK25902.1	4.50e-78	17	326	24	336
AMP08807.1	4.17e-48	19	326	12	323
AMO98916.1	4.17e-48	19	326	12	323
AIF53733.1	1.63e-47	2	327	5	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	6.79e-14	26	270	3	259	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	3.09e-13	26	270	3	259	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVW_A	2.47e-07	26	269	8	241	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	1.04e-06	26	269	8	241	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19816	7.44e-41	20	327	24	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	2.99e-40	18	327	23	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19817	1.39e-27	20	289	22	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	2.62e-25	21	287	25	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P25148	1.51e-18	20	288	3	279	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001060_01273.