CAZyme Information: MGYG000001060_01580

Basic Information

• Species: Dialister hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister hominis
• CAZyme ID: MGYG000001060_01580
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		23234.68	6.3545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001060	2084459	MAG	Spain	Europe

• Gene Location: Start: 20225; End: 20842 Strand: -

Full Sequence      

MRIALKRRKREVRRHQGNTGALVFVLLLALLSMLVLWLIHNSAFLRPSVEVSILIEKSAE
EQHVSPSLLQAVILTESKFDAKAVSHVGAVGMMQLMPETAEWISEESGLPADDLNRPDEN
IPLGAWYLNFLLKKYHNNEVLALAAYNAGRGNVDEWVEKYNWGEGLSKVDEIPFPETREF
VKTVVSARDRLEAERKEKEKEKNGS

Enzyme Prediction     

No EC number prediction in MGYG000001060_01580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	60	194	7.5e-31	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.71e-71	54	190	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.21e-54	54	186	9	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.71e-44	66	187	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.46e-33	55	165	1	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.23e-30	43	184	131	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	1.40e-139	1	205	1	205
AOH39655.1	1.70e-59	17	197	13	192
AXB81730.1	6.39e-45	54	185	45	179
ALG43012.1	7.27e-44	12	185	1	179
CCC73618.1	7.89e-44	54	185	13	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.63e-21	57	186	422	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.64e-21	57	186	426	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.65e-21	57	186	432	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.66e-21	57	186	442	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O24_A	1.66e-21	57	186	436	564	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.29e-20	55	186	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	6.64e-17	63	186	440	567	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39434	5.79e-16	64	186	493	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	4.30e-15	55	186	1426	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.30e-15	55	186	1426	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39