CAZyme Information: MGYG000001062_00240

Basic Information

• Species: CAG-1427 sp900556585
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900556585
• CAZyme ID: MGYG000001062_00240
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		84434.7	4.387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001062	1871556	MAG	Spain	Europe

• Gene Location: Start: 2255; End: 4582 Strand: +

Full Sequence      

MDNGIPFGVYIYSYATTTSRASSEADHVLRLLSEAGLDPIDLGYPVFLDMEDASTLYADH
AAIATTFCNKIEAAGYSAGVYSSTGWFNERLTDPCFDNWTKWVAQWNTSMGLTYNGLSNF
ESGNGMWQFSDYGSIPGINGAVDLDYTYMDPVNISTVEDAYQEPDKPYETPLSDGEYIIN
TALSVSSVLDIESASKNDGAKAQIYTSNNTEAQRFKLEADQTTGFYKIINVSSGKALGLQ
HYDNGSYSTAVSQYSDYSDNNSFKWIIENNGDGTCTVRSAVNTEYVLDVQSASTANSTPV
QIYKQNNSRAQQWFFLPTSPNVTAEKTLNDGLYYIQSSLDKSKVLDVASASQNDKANVQL
YAGNNTAAQKFYFESDDEGFYVIRNLNSGKVLDVASGSLLLRANVQQYAYNGTDAQKWAV
RVNGDGTFTIVSKLSGQVLDLTSGSSANGTNVQTYYSNQSAAQRFVLVDAKGEKVIEDGT
YVINSALKNRLVVDVASASMIDGGNVQTYNVNGTGAQKFSFDYDEKTGCYTIKNVNSGKV
LDIKSATYANSTNVQQYSENGTLAQKWLLSTNTDGTVKIASASQPSYVLDVASASTAPGA
NVQIYRSNDTLAQKWNIEKEDYNPPLPKPVIPEGIYVIESALHSDKVVDVAAASKLDRAN
VQLYDSNGTNAQRFNISFDPETELYTITNVNSGKVLDVASAAAANKTNVQQFTSNGTKAQ
KWIIVKNSDETYTIQSALGNYVLDVNSASVNNGANIQIYSNNRTNAQKWHFLSVS

Enzyme Prediction     

No EC number prediction in MGYG000001062_00240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	2	138	5.8e-24	0.7344632768361582
CBM13	658	773	8.4e-23	0.5851063829787234
CBM13	329	418	6e-20	0.4574468085106383
CBM13	477	577	8.5e-19	0.5106382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.78e-45	2	148	53	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
pfam14200	RicinB_lectin_2	1.68e-27	367	455	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	6.32e-22	670	759	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	4.31e-20	516	605	2	89	Ricin-type beta-trefoil lectin domain-like.
cd00599	GH25_muramidase	8.92e-16	2	146	49	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK44097.1	2.69e-152	1	537	677	1212
BAQ29887.1	5.15e-42	4	535	246	785
QTB90054.1	5.73e-42	4	679	236	915
BAR06175.1	2.41e-41	4	371	354	738
AIZ15211.1	2.46e-41	4	379	279	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.60e-09	4	148	321	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.06e-08	4	148	321	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
6IFA_A	2.81e-06	187	289	14	106	Structureof beta-trefoil lectin from Entamoeba histolytica [Entamoeba histolytica HM-1:IMSS],6IFA_B Structure of beta-trefoil lectin from Entamoeba histolytica [Entamoeba histolytica HM-1:IMSS],6IFA_C Structure of beta-trefoil lectin from Entamoeba histolytica [Entamoeba histolytica HM-1:IMSS]
6IFB_A	3.19e-06	187	289	20	112	Structureof rhamnose bound beta-trefoil lectin from Entamoeba histolytica [Entamoeba histolytica HM-1:IMSS],6IFB_B Structure of rhamnose bound beta-trefoil lectin from Entamoeba histolytica [Entamoeba histolytica HM-1:IMSS]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001062_00240.