CAZyme Information: MGYG000001062_01124

Basic Information

• Species: CAG-1427 sp900556585
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900556585
• CAZyme ID: MGYG000001062_01124
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38684.81	6.0766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001062	1871556	MAG	Spain	Europe

• Gene Location: Start: 12425; End: 13471 Strand: -

Full Sequence      

MSDDMPYPSTRYCDFDSRMLKAFKTAFTRKVMEAVCAFKPDLIICHHLYIVTAVVTHLRL
DCPVVGICHGTCLRQLGKHDLDKSYICEGVRLLDHVFVLTDVQKQAVIELIGKGDQTSLP
PISVLGTGYNSTIFHVSDTPKPQKRELLYVGKIADQKGVSSLLRAVDMLPWQKDELHVNL
VGGGSEEHAHIVRAAKESRFDVSMPGKMDQKDLAGSYQRAHVFVLPSFYEGLPLVIAEAL
ACGCVVVCTDLPGVRDWLLGVVPDAPVIFVTPPRMKSIDVPFEEDLPRFEQELSNGIVRA
FEMVDSAFSTYSEIKSNCAIEDLSWNGLASRLLDTLFAEGCLLREKHC

Enzyme Prediction     

No EC number prediction in MGYG000001062_01124.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	140	257	6.2e-25	0.7375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.11e-35	6	273	57	317	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.98e-31	39	338	83	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	3.60e-27	39	256	81	300	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
pfam13692	Glyco_trans_1_4	1.57e-24	147	261	4	115	Glycosyl transferases group 1.
cd03811	GT4_GT28_WabH-like	7.70e-23	38	313	82	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR86382.1	1.46e-87	1	333	72	390
QKF07020.1	1.09e-79	1	333	97	419
ACU94827.1	4.68e-79	1	333	71	475
AUN15750.1	3.18e-77	1	332	72	397
CEJ75137.1	4.49e-77	1	332	72	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	3.18e-09	98	272	196	373	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
6LFL_A	1.43e-08	64	338	190	413	Crystalstructure of a class A GPCR [Homo sapiens]
6KP6_A	7.80e-08	148	338	242	417	Thestructural study of mutation induced inactivation of Human muscarinic receptor M4 [Homo sapiens]
7BR3_A	1.44e-07	148	336	286	456	Crystalstructure of the protein 1 [synthetic construct]
2BFW_A	5.41e-07	148	326	40	200	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY8	1.60e-09	37	260	105	333	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1
P9WMY9	1.60e-09	37	260	105	333	Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
O05083	5.74e-08	73	256	126	293	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
O32272	1.50e-06	123	256	188	321	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001062_01124.