CAZyme Information: MGYG000001062_01198

Basic Information

• Species: CAG-1427 sp900556585
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900556585
• CAZyme ID: MGYG000001062_01198
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	MGYG000001062_145|CGC1	94606.15	4.7526

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001062	1871556	MAG	Spain	Europe

• Gene Location: Start: 8347; End: 10854 Strand: -

Full Sequence      

MNVSFKTIRRSGDKVYILSEISDYDERLPVVLSASTESGALIPSDTFPYCDINDTFALRD
VLYDGSLANQGMPLAPLHTKNSAGVRFFVISLPWLEVRRWDLIFRAIDATGSVVDSCKKS
LDTLTTSIKAIASQRTSPETGELIEDLDGRFVHDRIHVSFLRAVEIDDSYRVSALLEMPY
HEETFVECDFLDSHGSALSLDYMVVEDSIAQPAAYGSLRRRYMVVSFLVDKDNPYLCLCA
TDTQGTISPGFAMLGSRSLDSLLKRFRDRTTSAFNDSGYNEWFHTVHRADVPALLEQVAT
RFTYEPTFSIVCLLTDDPDHHIYDFINSVAQQSYGKWELIMVDMLGTKGRVSDLKELLDD
DRFYVIDADPSIGIDDNFASGLAAAEGDFMVFTQVRDVLAPDALFEFVRTINEYPDCDFL
YSDVDTCDAQGVHSQPLFRPDFSPELLRSYNYIRDLVVMRESLYAEISPLSFSMFAACGY
ELVLRATEKARRVCHVPRVLCHRRLATVESPSAKLSRLEQEVGRKALIDHCQRIGLNAEV
LNEDVMGHYRIRRILTEHPKVSIIVFYEGDAKLLATCIESLYKKIEYQNFEVLVVDAGNH
SQEDQEYFEQLESSFETFSLLTWDEPINRSKMANYAITEADGEFFLFLNSDACILSNNAL
DVLLGYFQSPEVAIVGPKQLFVDGTIEHAGIVVGGSRVVTPLFRYLPSTWHGYLDRARVA
QNVSAVTGECMMIRRRAYEKVGGFSEELALFYADVDFCLKVRDAGYLTVYTPFVELSHLK
SASRLRIHSKELRIKRRQEIAYLQGAWPRDFVEGDTFCNPNLDHDSSYFALKHTT

Enzyme Prediction     

No EC number prediction in MGYG000001062_01198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	560	780	4.4e-17	0.9130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.60e-48	326	504	21	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.66e-33	562	779	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.13e-23	559	803	3	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.22e-16	326	505	17	195	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	3.62e-13	571	747	9	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	2.10e-160	1	831	1	829
ACV56016.1	1.58e-114	86	833	43	793
QRT49544.1	2.72e-113	247	832	10	592
ATP53720.1	6.56e-113	69	822	54	811
AZH69456.1	6.85e-112	69	822	54	811

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	9.59e-72	295	832	355	898	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.85e-69	279	784	293	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	1.03e-07	670	790	120	254	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	1.03e-07	670	790	120	254	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001062_01198.