CAZyme Information: MGYG000001063_01168

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_01168
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027	MGYG000001063_32|CGC3	116826.68	5.2202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 74676; End: 77759 Strand: -

Full Sequence      

MKNDQFADIAAGGVNTENKGLDNIVPPAMDYPELELQKGIKSMAFPKKMDTKEELYQELE
KQKEYYRQYLRKLAPAMEPLRHRIKLDRFDWRIAEPKDKLSFSRVITGEGSWEQVEIPHY
GGPLGSQTTYYRTVFHAEKQEGKALFLHFDGVDYLANVFVNGSLAGSHEGFFAAFEFDIT
DYVVNGENILVVEVVNDFVQKRNEEKYRGEMLGGDKIYAATGPGYDDPLLGWHHCPPGMG
IYQGVYLEMRSRCFIRDSFVRPLPDTEQAELWLEIYKCDPGYEDLTIQYSLYGRNFEEVV
FEGKTYTPFTGCEIGLGDTFTKASLTANGQINQPVKIYMEKGINYLKVPFDLPDARIWTP
QTPYLYELQIHLVEKNGTITDNKNQSFGMRSFTMETDTVPKGTFYLNGEKIRLRGANTMG
HEQQCVMKGDFDQLLDDLLLAKICNMNFLRLTQRPVQEEVYDYCDMVGLMTQTDLPLFGV
LRRNQFTEALRQTEEMEKLVRRHPCNILVSYINEPFPNAYNQPHRHLGRKELMNFFDCAD
MIVKMNNPERVIKHVDGDYDPPSKTLPDNHCYTCWYNGHGVDAGALHKGYWIPIRHGWNC
GCGEFGTEGLDYEAVMRKYYPSSWLPGNQEEERSWSAGSICGSQTGNFHYFFFDTPDSLK
GWIEASQEHQAWAAKWMTEAFRRNARMVSIAIHLFIDAFPAGWMKTIMDVDRNPKPAYFA
YRDALTPVMVSLRTDRFTCFAGETVPVELWICNDTPANLEGYRCSYEILDENQEVLAQGS
TPAEAGASDSQCMGRIPVRTKKASGKALVRAAVQNKEGVILHTNQVEITVYEDNGFHTGR
QVIAPGMDGNAFRLLKDLGIDPVPLENAGMESIILVDDYNEYLNYKEEIDLIVQKGGRLI
FLELEPGTYQAAGREFTVKNSAMLPMNFVSNATRHPMAQGFGKKAFWNWYDKQADMITPI
LSSTVSGAGMRPILTSGNTDKNGNWQTAPAVVEAACQDGMVVVCQLKLFGRTKENPVAKL
FFEKLMQ

Enzyme Prediction     

No EC number prediction in MGYG000001063_01168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	84	817	8.4e-76	0.7207446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.86e-28	81	673	20	578	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.30e-18	130	560	113	479	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	4.58e-15	130	515	69	418	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	1.66e-10	112	218	55	160	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	1.06e-08	254	390	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96176.1	0.0	1	1026	5	1046
AEE97824.1	0.0	2	1026	21	1049
QUI23767.1	0.0	2	1021	5	1027
QNK56944.1	0.0	4	1026	21	1066
QDH23079.1	0.0	2	1026	8	1038

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.63e-22	131	732	84	660	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6MVF_A	2.09e-20	91	635	34	526	Crystalstructure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_B Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_C Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_D Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_E Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_F Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6]
6ED1_A	7.19e-20	91	514	33	421	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6SD0_A	5.67e-19	90	514	45	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	5.67e-19	90	514	44	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	2.27e-24	90	505	11	378	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.47e-21	105	621	72	509	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P06864	4.45e-19	107	514	91	449	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	3.10e-18	90	514	45	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q9K9C6	6.75e-18	116	477	113	406	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_01168.