CAZyme Information: MGYG000001063_01335

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_01335
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		90482.67	5.0221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 283183; End: 285567 Strand: -

Full Sequence      

MKDAFKREIEESLYIHSMLPLHREKSLEASFPGKKVVKRKELWSCGGQASAPLAGEKGKL
RIGMEQNEEYVSITAPVRSDTWPKGAPADGDYSNFGMAEVHFELPEEDWSEYNRLHFWVK
PQVPGSEIVHLNVGIKSNGTVKIPDRFCREGFTVFDLNNNQWNECFWEFSMLPRDRVTEL
YFYTFLNGQDTAMGPELTYSYKDIGIEKVENPEKEWGWECGSSRIVLSSAGYFIEGRKTA
VANIMEPEFTVCDERTGKAVYTGTVETVSNERGDFQVLDFSSVYEEGSYYLQAGGVKSPV
FEISDDIVEENVWRVLNFLYGERCGMPITGKHGACHFDIVAEHHGLKMPFAGGWHDAGDA
SQQSAQTGEIVHALLEVASKYKDKSPRLYQRILEEARWGLDFILRTRFGDGYRATSAGST
RWTNGLIGDMDDVNTRVYNHAYENFLFSGIEAYAYQQLKEEDEPLAWGSLEAAKEDFLFA
EKRFRDHGMEMVQMFEHTYNSGLSQHCAVIVWAASTLYAATSDEGYAKKAEYWCDKLMEC
QETGKAGIRISGFFYRDESHKMIVHFNHQSRVQQFMQAFVSICETQPDAPKKSLWVDAMK
RYAGYLKAIAANTAPYGMLPAGVHKMDEYKNSEVFQYLHVTCNYEEERENYKEQLKNGAL
IGKDYVIRNFPIWFSFRGNTVVMLSEGKAASLLGHYLQDEELLQMGREQLYWIFGKNPFG
HSLMYGAGSRYPAQYAIFPGECVGELPVGIETLDNEDVPYWPQGNNATYREVWTSSACRW
LWLAADYAGGKNCN

Enzyme Prediction     

No EC number prediction in MGYG000001063_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	313	734	1.1e-36	0.8421052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02850	E_set_Cellulase_N	6.80e-19	224	303	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	2.47e-13	223	298	1	83	Cellulase N-terminal ig-like domain.
pfam00759	Glyco_hydro_9	2.29e-07	316	732	7	310	Glycosyl hydrolase family 9.
PLN00119	PLN00119	4.78e-04	697	734	372	409	endoglucanase
PLN02340	PLN02340	0.009	697	732	377	412	endoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU26859.1	1.15e-34	225	791	65	623
ABW27815.1	1.24e-21	224	526	17	356
QUY42379.1	2.48e-21	224	526	40	381
AFZ21278.1	1.53e-19	219	482	85	378
AKJ64468.1	7.50e-19	254	760	84	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CJ0_A	3.13e-17	223	531	28	360	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	3.22e-17	223	531	42	374	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]
3X17_A	2.41e-12	223	436	16	265	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
3H7L_A	6.36e-10	223	773	2	544	ChainA, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_B Chain B, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_C Chain C, ENDOGLUCANASE [Vibrio parahaemolyticus]
5DGQ_A	2.29e-08	273	541	59	346	Crystalstructure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGQ_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGR_A Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum],5DGR_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S4	1.71e-16	223	531	28	360	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	1.80e-16	223	531	52	384	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_01335.