CAZyme Information: MGYG000001063_01738

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_01738
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1908	MGYG000001063_50|CGC1	207203.36	4.149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 55616; End: 61342 Strand: +

Full Sequence      

MKESGKRRRRLSSAAAICLAAAMVVTNMQTAVAFAAEISGGTAESETDSMGEQREKESVL
ESEQESEQESEQETEVIHQVDSMQAGNTGRFLFGTKADNGVTSKNLYSDETGFGFSDLTY
PEAAPGWQGNVYYPRNAFLTTGSAAYITDQESCLQIASQVWTETEHTGYGVYTYENTSTL
DLKLEAKDYDITVELVNPTEMDYTARLEAEDITKATGVTVEAGSRKTVTFHTCLVDGILN
LKFLAENKAVSENEAAEQSVYIESMEIAASPEKSAGEKPTIFLASDSTVQTYEDYYDPQT
GWGEALHNFIGNYIGEGPCEDCNYNQSRSYETDQVIIENRAIGGRSSRSFIEEGKLDDLL
EDVKPGDYLLVQWGHNDATSSRPNRYVSPEDFGKWIKYYIDGAKQRGAACILVTPAARYS
YNADGTFNENFKAYGDVMRTIAAQENIPLADLSAASIALCESFGIEGAKSLFLWVEPGEY
EGAYAGGATDSTHLQYYGAYKFAQCVAAEIAGMPQNVDPLISRLQSFINLKESADVPQAV
TGLMPVTAGASSVSMQWDASQGAEMYYIFREELTEGASGETVDFTNAEKYSVTAGTRYTD
NGCAGGKTYVYAVCGYNEKGLGELSEKITVTTKSAQYKYDFNYNNSPTMEGWTGVNQNQE
YTKEAGYGWLKAPNNGRNRSGNENADSSAMADDFNLGAGEFAVDLPNGDYEIKVYAGDLL
PGTSTIKASYMAEGKAAGGISTKQSLASMAASVRVTDGQLNLTVGGSNPYINGLEITPVL
LAPSGLNYSEMSFEGNSASFLIGFTGVGEAAAYRIYRKGQADEGFAVVKSFTAEEYQADE
LSCRSMKASMGETYQYYMTAVTADGTESAPGNVIEIDMLDPGVEKPAPPANVKCDSAKNG
EMILSWDSTDTAFKYMVYRSDKAEGDKGFKEFIKVAETQVPGFTDTGDDLTANISYYYKI
KAVNAGGAGDFSEVCKTDVTTELMASPGETLTDRGVIAVNLAGADGGESVVTAADASGKE
YTSGVYLSWRSFEKDPKGTTFDIYRNETKIAENLAVTNLVDEGGRASDIYRVEGSSDVEL
GIKVLDTAVWQDKYLELKLYSPADQTMPDGTACTYAANDMSVGDLDGDGQLELVVKWYPS
NAQDNSAKGYTGTTFLDGYDVNFATGEVSLLWRIDMGVNIRSGAHYTQFQVWDFDGDGKA
EIAVKTADGTTSYQSTDGTDAGLVEVAYTGACNAASLPVDQISEEHDYRNAAGYILEGPE
YFSMFNCDDASLIDTVDYEPGRGNVNAWGDGYGNRVDRFLSAVAYLNGTTPSAVFCRGYY
TRTCLTAYYLADTDGDGAGDKIQTYWKFDTNEAGSQYEAQGNHGLSVNDIDNDGKDEIIY
GSLVIDHNGTVKYSTNQGHGDAMHVSDWVNWNEGLEVMAVHEHDDASYHVEIHDAETGKI
LMGYHVGRDTGRGVAADIDPTASGAEFWSIASPDSSAEEEPSWDSRNGGVYSTMSTLENL
ITLSGKSPASNASIFWDGDLLSEIQDHRFDSDAYKPLAVNLAKWDYENNQEVTLFDSTEI
LSNNGTKGNTGLTADILGDWREEIISRSSSGQNKIRIYASTIQTDYVVPCLLENRAYRQG
VAWQNVAYNQPANLSYLLSEGLITAQLTAQEDRSLSDSLTFTFTPASDGVYGHEITAYEI
YRSEDGKSYSLIDTLPADNKQEAYTYTDHKLEADTVYYYKTAAVVDGKNSYGSKPVEMKT
KRKASEVLYRFDFGITSDKTAQGWIGITVNGKGGSRTNDELGITYSKEKKFGFADGAAII
TGRSEDYTYNKGGITADVYQDFALPDGNTFCADVPNGSYQVEIVGGSVYKSTVKGNLEGT
VAVKVESGANSYAVGTYEVEVTDGQLNFNCAPNSISRLDAMIITRIEK

Enzyme Prediction     

No EC number prediction in MGYG000001063_01738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	1022	1644	4e-212	0.9588336192109777
CE12	280	510	9e-62	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	993	1636	5	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd01821	Rhamnogalacturan_acetylesterase_like	1.63e-60	279	510	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG3401	FN3	1.67e-19	623	967	21	330	Fibronectin type 3 domain [General function prediction only].
pfam18370	RGI_lyase	2.54e-12	989	1073	4	69	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
COG2755	TesA	7.97e-12	279	511	9	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93926.1	0.0	91	1906	51	2107
ADL33943.1	0.0	97	1851	169	1930
AYA78488.1	2.26e-311	90	1688	25	1461
QNF30995.1	1.07e-305	148	1642	33	1415
QYR24106.1	3.39e-305	178	1644	56	1388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUY_A	5.48e-158	1024	1642	23	593	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
4CAG_A	1.28e-157	1023	1646	25	583	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	1.20e-150	1024	1642	20	572	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2O14_A	6.38e-16	157	472	57	335	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
1DEO_A	4.18e-08	280	427	2	121	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	2.32e-157	1024	1642	23	593	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	1.67e-149	1024	1642	57	609	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31528	1.48e-38	281	514	5	208	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	3.72e-35	281	523	8	226	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
P42304	2.75e-16	157	473	72	351	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000522	0.998678	0.000196	0.000226	0.000185	0.000156

TMHMM  Annotations     

start	end
13	35