CAZyme Information: MGYG000001063_04016

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_04016
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000001063_108|CGC1	52418.81	6.0898

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 13521; End: 14921 Strand: -

Full Sequence      

MKYSDHKIKDMKITYIGGGSRGWAWVFMGDLAKEEALGGTVCLYDIDQEAARHNKVIGDA
LTARADTPGKWNYEVADSLRDALTGSDFIIISILPGTFAEMQSDVHAPEKYGIYQSVGDT
AGPGGMIRAMRTIPMFAEIAQGIKMYAPEAWVINYTNPMSVCVKTLYHVFPEIKAFGCCH
EVFGTQKIIKGILEETTEMTGISRSDIHVNVLGINHFTWFDQASYEGMDLMPVYRDYVKS
HFEEGYEENDKNWANSTFNCAHRVKFDLFCKYGLIAAAGDRHLAEFLPSGHYLKDPETAA
HWKFGLTTVEWRKQDLEERLQKSRRLVSGKEKMKLEDSGEEGIALIKALCGLTRVVSNVN
ITNNAGQIKNLPADAVVETNALFERDSIKPLYAGKLPGNIRELIMPHVENHERTLKAALN
CDRQLLKEAFLHDPLIHGRISGEQTESLIDEMLRNTSKYLPEAWQI

Enzyme Prediction     

No EC number prediction in MGYG000001063_04016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	1.1e-55	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.46e-165	11	453	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.32e-114	9	462	2	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	6.08e-71	11	463	2	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.39e-56	12	195	1	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	2.93e-56	11	453	1	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08117.1	3.39e-245	1	465	1	465
ABX43208.1	7.59e-245	1	465	23	487
BCJ94352.1	1.03e-242	1	464	1	464
QOV18776.1	1.50e-239	1	465	1	466
ABX43749.1	2.13e-239	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.22e-151	8	454	3	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.59e-29	9	465	3	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	3.06e-29	4	465	1	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	4.01e-20	4	265	22	277	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
1UP7_A	1.30e-18	9	460	1	414	Structureof the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_B Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_C Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_D Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_E Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_F Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_G Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8],1UP7_H Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	4.25e-240	1	466	1	466	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	1.17e-201	1	466	1	463	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.69e-181	1	464	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.26e-154	8	454	7	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	8.58e-48	12	462	3	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_04016.