CAZyme Information: MGYG000001063_05251

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_05251
• CAZy Family: GH110
• CAZyme Description: Alpha-1,3-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000001063_134|CGC3	45989.53	6.3002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 38574; End: 39758 Strand: -

Full Sequence      

MNNLEVRKWNILPADRKENTWYLRKLLDEYRGREDVNIEFESGTYHFYPDYARETLLFIS
NHDEDTIKKAAFDLSDYKKLKLKGNNSHFIFHTDMIPFLLNRCEDIVIEGITVDLARAGH
SQGIIRYADEKRIDLEIDQKEYPYFIKHRRLYFTGENYCHELNRWMELDQERLEPVYGNV
DRSFNMPDAGETAVWEEKEPGLLCVRLPEDGQRFDAASRVGNPVIFRHHPRNCPAFYLEN
CVKIYLRDVTVYHAAGMGFIACRSENIHLERYNVMRKPGRNEVFTTEADAIQMIGCRGKL
LIKDCLLENQLDDGINIHGVYAQIVDVMPDHRILIKLVHHQHKGMPVLKSGESFRVLDGD
SMLPVCCQKAISAEILNREFLMIRTDGNQECLKA

Enzyme Prediction     

No EC number prediction in MGYG000001063_05251.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	5	383	1.2e-90	0.6678832116788321

CDD Domains     

MGYG000001063_05251 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31546.1	5.65e-121	1	384	1	386
SDS24258.1	1.46e-73	4	383	30	401
AJY75339.1	9.14e-61	4	387	5	378
QUT74394.1	3.96e-58	31	383	31	371
QGY42333.1	1.68e-56	12	382	47	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	1.98e-51	4	384	28	416	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	1.01e-50	4	384	28	416	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KD83	6.38e-49	3	365	32	384	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1
B2UNU8	1.58e-45	4	364	219	568	Alpha-1,3-galactosidase B OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=glaB PE=3 SV=1
Q89ZX0	4.03e-43	4	382	28	401	Alpha-1,3-galactosidase B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaB PE=3 SV=1
A6L2M8	1.87e-38	4	362	24	376	Alpha-1,3-galactosidase B OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=glaB2 PE=3 SV=1
Q64XV2	6.06e-38	8	373	39	391	Alpha-1,3-galactosidase B OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_05251.