CAZyme Information: MGYG000001064_00044

Basic Information

• Species: Streptococcus sp900755085
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900755085
• CAZyme ID: MGYG000001064_00044
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		83071.42	5.0836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001064	1854245	MAG	Sweden	Europe

• Gene Location: Start: 259; End: 2493 Strand: -

Full Sequence      

MKEHQEESEHSSPATSEKESRSVSQGTEAIQPATSLDEEPEIADYGPLPSKAQMQYHREE
LAAFIHFGMNTYYDREWGDGQEDPYDFYPEHLDTDQWIKTLKDAGFKRTIMVVKHHDGFL
LYPSKYTDHTIAKSGWKDGKGDVLAEVSASASKYDMDMGVYLSPWDAHSPLYHVDTEDQY
NQYYLNQLKEILEDPKYGNKGKFVEVWMDGARGDGAQKVIYTFDKWFDAIHRAQGDIAIF
SAEPTNVRWIGNEKGIAGDPVWQKVNPDKIRNNPSNSYLNHGDPEGEQYSVGEADVSIRS
GWFYHDNQEPKSLRELMDIYFKSVGRGTPLLLNIPPNQDGKFADADVVRLKEFRYTLDQL
YSVNYAAGALVEAESTRRNSLYKASHLTDGDEKTSWAPADDAKTGSFVLDLGKEQHFDVV
ELKETIEKGQRISGFTIDVAVKGQWVPYGVGSTIGYRRLIKGQPVDSRYIRVSISDAQAT
PILNGVSVYKTPTSIEETDGYPLGLTYHSDRTAERTNGQWNEEGEGVRGTSMWTKEKGAS
VTYQFEGTKAYVVATVDPGHGEMDVSVDGQKLVTVSTQSPRRKRSQKVYETPDLAAGSHT
LTLVNSKGDTIATEGIYALNNQEKGLFEFAQPTLAVKKGEPAQIVVKRKGGSKGSASLKL
ITEPGTGVHGKVYKDTNVTLEFADGETEKNVQIPILDFAGKSTDVYDFKVKLLHPDQGSL
VGFITELTVQVMEEVVQQSKWKKA

Enzyme Prediction     

No EC number prediction in MGYG000001064_00044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	50	354	8.5e-69	0.8526011560693642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.63e-102	46	489	8	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	5.12e-28	64	352	30	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.06e-26	43	353	9	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
smart00237	Calx_beta	4.39e-09	625	697	2	75	Domains in Na-Ca exchangers and integrin-beta4. Domain in Na-Ca exchangers and integrin subunit beta4 (and some cyanobacterial proteins)
pfam00754	F5_F8_type_C	1.25e-07	375	474	5	112	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH56390.1	0.0	1	734	67	800
VEE18999.1	0.0	1	734	67	800
VED68021.1	0.0	1	734	67	800
AYF93755.1	0.0	1	734	67	800
AGY39008.1	0.0	1	734	67	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ORG_A	2.85e-192	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	4.45e-191	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	4.61e-191	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6TR3_A	1.21e-117	48	525	27	546	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	1.85e-116	48	525	27	546	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	5.46e-111	47	495	38	482	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	6.52e-109	47	489	36	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001064_00044.