CAZyme Information: MGYG000001064_00734

Basic Information

• Species: Streptococcus sp900755085
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900755085
• CAZyme ID: MGYG000001064_00734
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001064_76|CGC1	42437.25	8.9238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001064	1854245	MAG	Sweden	Europe

• Gene Location: Start: 13364; End: 14467 Strand: -

Full Sequence      

MKTKKMRYVWFLVILCIFCLTLFLARTRSKVDMRNRIYRQWNEHFVVSKGKESYVRTTND
SNQTVVLSEAQSYGMLITVAAAEKGQAQQADFDRLYQYYLNHRLEGTQLMSWKQTISNGK
ANDEDHNATDGDLYIAYALLKAAQQWPKQAKDYQAQAKAILEDILAHNYNEETGVLTVGN
WANQDSGFYHLMRTSDTLPAQFQIFYEVTKDSKWLDIKEKMLQQLQTISSQTKTGLLPDF
IWVDEQGTRVADPKTIESKYDGAYSYNACRLPYNLVQSKDAASQKLVKRMLNFFKSQRNL
YAGYDLKGKALNNHQAASFLAPIVYASEHEKGYLKLVQQNKYIFTQDLPLNNYYDATMTT
MIALELF

Enzyme Prediction     

No EC number prediction in MGYG000001064_00734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	364	4.9e-73	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.99e-24	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.67e-22	5	331	1	319	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	6.44e-12	38	270	28	248	cellulase.
cd04791	LanC_SerThrkinase	3.56e-04	98	250	57	196	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH56684.1	1.87e-234	1	367	1	367
AFJ25304.1	6.25e-233	1	367	1	367
QUB39088.1	1.47e-231	1	367	1	367
AGY40742.1	3.61e-202	1	367	1	367
AGY37425.1	3.61e-202	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.50e-36	41	322	69	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.02e-22	68	327	73	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.13e-22	68	327	79	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	5.76e-09	68	361	33	308	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	1.10e-07	68	272	48	242	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	2.46e-35	27	322	54	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	4.97e-23	68	326	129	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	1.95e-08	68	272	56	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	2.86e-07	38	295	28	269	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	5.07e-07	38	295	28	269	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.883668	0.096726	0.017929	0.000308	0.000219	0.001156

TMHMM  Annotations     

start	end
7	25