CAZyme Information: MGYG000001064_01311

Basic Information

• Species: Streptococcus sp900755085
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900755085
• CAZyme ID: MGYG000001064_01311
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000001064_137|CGC1	73306.34	6.3938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001064	1854245	MAG	Sweden	Europe

• Gene Location: Start: 6406; End: 8433 Strand: -

Full Sequence      

MNHLNKDIVFGIRKSKLGVFSVVIAIMGACFLTGQSVAADQVGEQAQVQTQGQEATTSDP
ASSQVDTSQYGASMPYTRYEADKGNLLGKAEVEQSQDSHSTAIEASDQTYVALKEKGDGV
SFKVNEPANALTVRYTVPDGASGQLDVQVNGHSVQQLDLSSSSNWQYLNDKGVHDSAQAD
TRARFQFDEVHSLLPGIQLQKGDVVSLVKNKADDVHYGLDFVEFEQAPDPIAQGDNAINI
VSKGATPNDDTDDSQALYDAIYEAKQTGKNVYIPAGRFNLNRKVGIDASDMKISGAGIWH
TQLHFTSDQAGGGGFDFLHQDNHVEFSDVYLSSNLRSRYGENAQYKAISGTPGKNSHIHD
IWAEHFEVGMWIGDYAGKNDMKYTDGLVVENVRLRNNLADGVNFAQGTKNSIVRNSSIRG
NGDDGLASWSSIADGTESAVAENNKFLHNTIELGWRAGGVGIFGGKGHEIAYNRIKENIG
DAGIRLTTVFKGHNFDLNEEGIRVHHNLLERTGTKSDIYNKDRGSIDVETRYGDIKNVTI
EDNVFVAPFDTGVTDHLNPNGGILNHVEVRNNQTMSQLSHSAQAGLSAPASKPVGQALKV
KEKPLQAGAVKASLQPSKVQPSKKQTGLNLKQAKTVTETVKPNYVLKSTNSKQKSFLKAP
SALFLYRMMGLRQTV

Enzyme Prediction     

No EC number prediction in MGYG000001064_01311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	67	577	1.2e-136	0.7939698492462312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	4.64e-34	71	224	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04086	CBM35_mannanase-like	1.32e-04	77	166	1	86	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	1.67e-04	77	165	1	87	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam13229	Beta_helix	1.81e-04	381	573	5	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam12708	Pectate_lyase_3	0.005	238	316	2	81	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW09800.1	0.0	1	675	1	675
ARC34101.1	8.90e-208	35	543	98	612
ARC49812.1	3.71e-207	35	543	98	612
ARC23745.1	1.47e-206	35	543	98	612
CCB95088.1	1.51e-206	35	543	99	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	6.93e-119	68	539	10	488	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	4.75e-47	71	547	54	501	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	1.49e-29	71	513	14	443	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	1.52e-28	71	513	14	443	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	1.52e-28	71	513	14	443	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004215	0.745845	0.248829	0.000550	0.000292	0.000247

TMHMM  Annotations     

start	end
17	39