CAZyme Information: MGYG000001065_00929

Basic Information

• Species: Enterocloster sp900538485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900538485
• CAZyme ID: MGYG000001065_00929
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000001065_16|CGC1	43944.18	5.3858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001065	3284441	MAG	Sweden	Europe

• Gene Location: Start: 77076; End: 78248 Strand: -

Full Sequence      

MKKRTFAVCLAAIQLALSFSSYAGQWQQDQNGWKYKTDSGDHMKNTWYQDSDSRWYYFGP
DGYMKSSTMTPDGYVVGSDGAWIEPLGKSGDQAVSPWFYQSMLGKGLDVTWSEFPKQTAS
YSEQMVKDFKAAGVSHVRIRVKDDISAELLASLDQQINDCLNNGIIPILAYQAHAFKENP
CQETMDHVTAWWTAMAEHYQDSSHLLAFDLMIEASDAVNQLPEALNQLYEQTVSAIRQTN
PSRIVIISPRLRSDPYYLHELKIPSAHNGYLMAEWHFYASGPDKVNEKKKWTTGTDEEKK
LITDKINAALSWQAQTGVPTWVGAWMPGNYNKGNSYSAEEQTAFASYMTSALTAAHIPFA
VNADTKYYDAKQQEWISDMQPVAAAIFSGR

Enzyme Prediction     

No EC number prediction in MGYG000001065_00929.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	120	360	8.2e-27	0.9580152671755725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.43e-14	123	350	27	258	Cellulase (glycosyl hydrolase family 5).
COG5263	COG5263	9.86e-09	26	83	257	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
pfam19085	Choline_bind_2	9.08e-06	43	82	3	38	Choline-binding repeat. this entry contains a pair of presumed choline-binding repeats that are often found adjacent to pfam01473.
NF033840	PspC_relate_1	1.21e-05	26	83	592	647	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033838	PspC_subgroup_1	1.17e-04	21	83	623	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	6.40e-136	91	390	2	301
QCJ07784.1	1.25e-120	94	386	29	321
QGH22373.1	1.25e-120	94	386	29	321
QGH26411.1	1.25e-120	94	386	29	321
QSX04350.1	1.25e-120	94	386	29	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	5.88e-16	82	324	64	314	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	1.91e-15	82	323	64	313	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	6.74e-14	82	323	64	324	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
6KDD_A	8.61e-10	99	386	16	317	endoglucanase[Fervidobacterium pennivorans DSM 9078]
3RJY_A	1.51e-09	94	379	11	313	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16218	2.16e-14	82	323	315	564	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000418	0.998660	0.000304	0.000229	0.000209	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001065_00929.