CAZyme Information: MGYG000001065_01624

Basic Information

• Species: Enterocloster sp900538485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900538485
• CAZyme ID: MGYG000001065_01624
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220		24609.83	8.1278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001065	3284441	MAG	Sweden	Europe

• Gene Location: Start: 4487; End: 5149 Strand: +

Full Sequence      

MSYSVYFKYGNKKYKLPVNPEEIKRNRELNIETYQVLGTGQVSVPSYYGLEEFSFEAEFP
SQDYHYMNPGAKADADYYEKMFRKAQKDLKPIRFIASNDITDDISIMVLVKSVEAVEKAG
EEGDKYLTIKLLEYKAPGKRYVAVQTAAATVKQEDTSASAETNPAVTENKTHAVQSGDTL
WGIAKKYYGNGSQYKKIAAANPGIKNPNLIYPGQVLTIPA

Enzyme Prediction     

No EC number prediction in MGYG000001065_01624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	172	219	6.9e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.08e-20	161	220	87	147	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	5.14e-16	135	220	176	263	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	3.69e-14	170	218	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
TIGR02899	spore_safA	5.46e-13	174	220	1	44	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
pfam01476	LysM	4.52e-12	172	219	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV21693.1	1.72e-113	1	220	1	220
ADL04006.1	1.72e-113	1	220	1	220
QOX63670.1	6.50e-66	3	219	4	220
AGC67443.1	5.26e-65	1	218	1	224
AGI38503.1	5.26e-65	1	218	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.39e-10	122	219	52	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]
3JC8_Ta	3.45e-07	170	214	79	123	ChainTa, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tb Chain Tb, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tc Chain Tc, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Td Chain Td, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Te Chain Te, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tf Chain Tf, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tg Chain Tg, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Th Chain Th, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Ti Chain Ti, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tj Chain Tj, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tk Chain Tk, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tl Chain Tl, LysM domain protein [Myxococcus xanthus DK 1622],3JC9_Ta Chain Ta, TsaP [Myxococcus xanthus DK 1622],3JC9_Tb Chain Tb, TsaP [Myxococcus xanthus DK 1622],3JC9_Tc Chain Tc, TsaP [Myxococcus xanthus DK 1622],3JC9_Td Chain Td, TsaP [Myxococcus xanthus DK 1622],3JC9_Te Chain Te, TsaP [Myxococcus xanthus DK 1622],3JC9_Tf Chain Tf, TsaP [Myxococcus xanthus DK 1622],3JC9_Tg Chain Tg, TsaP [Myxococcus xanthus DK 1622],3JC9_Th Chain Th, TsaP [Myxococcus xanthus DK 1622],3JC9_Ti Chain Ti, TsaP [Myxococcus xanthus DK 1622],3JC9_Tj Chain Tj, TsaP [Myxococcus xanthus DK 1622],3JC9_Tk Chain Tk, TsaP [Myxococcus xanthus DK 1622],3JC9_Tl Chain Tl, TsaP [Myxococcus xanthus DK 1622]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	1.26e-16	3	219	6	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	3.39e-16	3	219	6	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P0ADE6	6.54e-10	122	219	52	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	6.54e-10	122	219	52	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
Q9RVY3	2.32e-06	167	219	201	252	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001065_01624.