CAZyme Information: MGYG000001066.1_00037

Basic Information

• Species: F0422 sp001553345
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp001553345
• CAZyme ID: MGYG000001066.1_00037
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		61697.59	9.0216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001066.1	1773337	MAG	Sweden	Europe

• Gene Location: Start: 33285; End: 34892 Strand: +

Full Sequence      

MEQTFSWKRFAWLGIGTFLFYLFMAWALPVTDTVESNYALSAVTMMKYGEFLSPMIYDMY
WYDKPIMAYWGLILSYSLFGISDLAARLPSIVVSTCTVLAMYRMAFSIYQVERIAMWSAI
ALGTALEFWYIGHAVVTDGYLFLFSMGIFYYLYRGITGESHRHMVYAYMFAGLAVLTKGP
VGIVLPGIILILYVALNRRMDWFKYVFSWKGILAFILVVAPWYGYMYYVHGDAFIQGFLG
LHNVTRATVPEHPEHNWWYLYFALLPVCMMPWTSFVVRGINEQKHAYIWYWSIFWFVGTV
LFYTCMATKYVTYTFIMLIPLALWAGMGIHAGIEGYKERKMTWRVFTLYALGGFPFLLGL
VIVGLSVSLSHSAYLWISLAVTLLTFIYAASKRTGSVFVCSMATSTIIFYLALVPNLVPV
MEDQSGKVLANEVMTLEGTTPLEVYQYGNYRTSLSYYLGRTTSFIHYKEYESVWENGKNI
MPMVKPTDLAKDTEKLSRALIYVPNKYATYFKETNLYDQVQPVKRNSLGVFYKAK

Enzyme Prediction     

No EC number prediction in MGYG000001066.1_00037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	495	5.2e-82	0.9425925925925925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.02e-36	1	447	1	464	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	5.87e-17	63	222	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	5.09e-11	35	374	33	377	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	1.34e-05	26	230	23	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU36964.1	1.85e-105	9	535	8	538
SNV73216.1	5.75e-104	9	535	8	538
QQB17357.1	1.43e-103	9	535	8	546
SNV00837.1	1.43e-103	9	535	8	546
ACZ25181.1	1.43e-103	9	535	8	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.07e-09	35	274	59	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	5.72e-18	13	309	8	287	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	2.85e-16	8	460	3	437	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A0KGY4	2.41e-15	20	374	15	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B7VBN0	4.26e-15	35	326	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	5.65e-15	35	326	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31
59	81
88	110
114	133
140	157
172	194
207	229
258	280
287	306
311	333
345	367
372	390
397	419