CAZyme Information: MGYG000001066.1_01473

Basic Information

• Species: F0422 sp001553345
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp001553345
• CAZyme ID: MGYG000001066.1_01473
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	MGYG000001066.1_33|CGC1	21477.27	4.6547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001066.1	1773337	MAG	Sweden	Europe

• Gene Location: Start: 21174; End: 21737 Strand: +

Full Sequence      

MRVSTAFAWLIVVLTAYYVQYGQPYLARQYAYPLVYESAVMKNASTYHVRPSMVAAVIYT
ESKFDTNAKSLPGAIGLMQLMPETAHWIGEQLNQSSLSDQDIKEPNTNIQLGTWYLSYLL
EEFKGNEILALAAYNAGRGHVEEWMQTYGWDDNFDDIDKIPFPETKDYVKRVIANESQYQ
ALYSQLR

Enzyme Prediction     

No EC number prediction in MGYG000001066.1_01473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	41	180	2.1e-32	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.88e-78	33	175	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.57e-61	31	182	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.08e-38	51	175	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.18e-34	3	185	111	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.31e-33	42	150	3	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV63004.1	2.63e-58	1	183	1	180
ARF99123.1	5.28e-58	1	185	1	182
CAB1276067.1	7.49e-58	1	183	1	180
AXB81730.1	1.88e-57	28	184	34	190
ALG43012.1	5.35e-57	10	183	16	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.40e-23	36	183	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.42e-23	36	183	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.45e-23	36	183	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.47e-23	36	183	430	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.50e-23	36	183	436	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.62e-21	32	180	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.62e-21	32	180	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.01e-21	32	185	476	631	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	3.52e-21	36	178	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.52e-21	36	178	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.610382	0.387401	0.001105	0.000284	0.000235	0.000599

TMHMM  Annotations     

start	end
5	27