CAZyme Information: MGYG000001068_00006

Basic Information

• Species: Streptococcus sp000187445
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp000187445
• CAZyme ID: MGYG000001068_00006
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000001068_1|CGC1	26037.7	4.9362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001068	2029735	MAG	Sweden	Europe

• Gene Location: Start: 5472; End: 6185 Strand: -

Full Sequence      

MYRHLKKYLIFIVGAFICSLFLVLAFTTDRKNDNSVNAKAEAAYNQTTTAFIGSIGETAR
QIGQDYNIYASVLIAQAILESNSGQSGLSQAPYYNFFGIKGTYNGNSVTMRTWEDDGTGK
TYEVDQPFRSYGSLSDSLADYAALMTSSTYAGTWKSNTSSYADATQALTGTYATDSLYAS
KLNSIIAYYGLTAYDQSPVTQTTGSTGSLVWNRYRGSYTDAETLSIDEAWASYKNYK

Enzyme Prediction     

No EC number prediction in MGYG000001068_00006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	56	191	2.1e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	5.26e-62	32	197	304	474	amidase domain-containing protein.
COG1705	FlgJ	9.40e-61	6	208	2	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.51e-49	33	237	125	349	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	9.81e-28	44	194	4	144	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	8.93e-23	45	195	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC22574.1	1.09e-161	1	237	1	237
ARC49628.1	2.20e-161	1	237	1	237
ARC34461.1	2.20e-161	1	237	1	237
ALR80074.1	4.44e-161	1	237	1	237
ARI57160.1	6.30e-161	1	237	1	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.32e-42	26	195	10	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.79e-39	26	195	37	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.29e-09	51	186	6	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.65e-09	51	186	6	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	9.40e-38	48	207	62	222	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	1.84e-37	26	195	297	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	9.96e-36	46	204	178	342	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9CIT4	9.57e-35	41	208	56	227	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	3.51e-33	41	195	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.940072	0.027557	0.030559	0.000057	0.000054	0.001717

TMHMM  Annotations     

start	end
9	28