CAZyme Information: MGYG000001068_01181

Basic Information

• Species: Streptococcus sp000187445
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp000187445
• CAZyme ID: MGYG000001068_01181
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		81587.72	4.6574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001068	2029735	MAG	Sweden	Europe

• Gene Location: Start: 1192; End: 3357 Strand: +

Full Sequence      

MSITINKNYYYINSKELSLIIEEREGDLLLRHLGRKITNYHGSNAINERDHAFSGQLNPD
VRTYSYDTQRQVLGLHGLGDFRQPSLKIQHGVSDVTRFEFLKAEVVKGISLESKLPYPHS
LEKAETLIFTLVDKVADLELKLYYTVVEDNNTIVTYSEVINNSNQAVVIHRALSAMADVP
ARDYDVVTLQGAYAREKTVRRQRVEQGIFKVASNRGASGHAQTPALILCDHEASEGAGEA
LAFQLMYSGNFQTFVQKSQINEVRVAIGIEDENFTWELASNESFETPVALITYSHQGLTG
VSQESQAFVTDYIIPKQFAHEERPILLNNWEATYFDFEKEKLLELAEDAKQVGVELFVLD
DGWFGNRFDDNRALGDWFVNEEKLGGPLQDLIEKVHAKGLKFGLWFEPEMISVDSDLYRT
HPDWAIQVPNYGHTYSRNQLVLNLANPDVVTYLKDVLDKILTDNAIDYVKWDYNRNMTNI
GNGANYLESQMQSHQYMLGLYDLVEFLTSKHENILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMECTTPLETRGDVAMMGNLGYELDL
TSLTQEEKDIIAGQIAHYKDIRPVVQFGQQYRLINPEAGSNEAAVQFNYENKVLATYVRV
LSTVETVETTLKLKNLDQDANYMLQGTDQVYSGAELMYAGITVVLPQGDFLSKQFYFVKV
D

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	702	1.8e-248	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	0.0	283	628	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	0.0	8	720	2	687	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	5.99e-141	322	620	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.33e-77	26	279	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	7.17e-17	642	717	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI51282.1	0.0	1	721	1	721
QKH70034.1	0.0	1	721	1	721
ARI59808.1	0.0	1	721	1	721
QGU82329.1	0.0	1	721	1	721
QGU78308.1	0.0	1	721	1	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHW_A	0.0	1	720	21	740	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
6PHU_A	0.0	1	720	21	740	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
4FNQ_A	6.27e-199	1	712	1	719	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.00e-197	1	712	1	719	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	4.55e-196	1	712	1	719	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27756	0.0	1	719	1	719	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
Q9ALJ4	5.50e-197	1	712	1	719	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	3.69e-184	10	721	15	732	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	4.37e-174	10	720	13	730	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G4T4R7	5.54e-162	26	720	29	720	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001068_01181.