CAZyme Information: MGYG000001068_01299

Basic Information

• Species: Streptococcus sp000187445
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp000187445
• CAZyme ID: MGYG000001068_01299
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000001068_59|CGC1	39632.56	7.2587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001068	2029735	MAG	Sweden	Europe

• Gene Location: Start: 5040; End: 6092 Strand: +

Full Sequence      

MKYYLKEEFLHDNNAKNAGNKARNDVEVILNDLGYAPLKVIVDDWYKMNVLNAQIHKYRA
LLRIFKRLKKNDDIVIQFPLLHHSLFINSLLKSLKNKGVNIYLLIHDLETLRFVNDKTLP
FRMKLRMKLTESDTFHSVTGIIAHNSIMKSVLVDKGVAEDKIVSLGIFDYLIPNFQEKTG
LTKNQPIIVAGNLAQEKAGYLYSLPAEPAYNLYGVGFDESRALENETYFGSFLPDELPVA
LKGGFGLVWDGESAETCSGVFGEYLRYNNSHKASLYLASGFPLVVWKQSALSHFVLEQGC
GIAVDSLYDLKATIENLSEDDYQTLVKNTKRVGQEIRDGHYLITALNNLK

Enzyme Prediction     

No EC number prediction in MGYG000001068_01299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	12	349	1.8e-102	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.01e-93	1	349	1	329	sugar transferase.
cd03794	GT4_WbuB-like	1.34e-05	23	320	56	362	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB38817.1	1.26e-228	1	349	1	349
ALR79904.1	2.09e-227	1	350	1	350
QEW10543.1	1.23e-219	1	349	1	349
QKH69719.1	7.06e-196	1	350	1	350
QBS00018.1	1.58e-192	1	350	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	8.11e-13	23	341	23	317	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	8.49e-13	23	341	31	325	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.82e-42	9	349	3	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	1.52e-18	22	341	20	320	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.56e-16	10	346	8	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	3.49e-15	10	346	13	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	4.38e-12	23	341	21	315	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001068_01299.