CAZyme Information: MGYG000001069_01763

Basic Information

• Species: UBA4871 sp900554535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp900554535
• CAZyme ID: MGYG000001069_01763
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		39171.02	8.4678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001069	2409721	MAG	Sweden	Europe

• Gene Location: Start: 23621; End: 24643 Strand: -

Full Sequence      

MDENHLNLLYGATSSYCAQTATSMYSVLRKNPWAARIDVYVLCEGVPASAREKLQQTVRD
FPNAHVHFLFAETVLKPLREKFSLRAWNGSYNQYIYACLCDAFPELSRILWLDGDVVCVG
SLEALWKWDLTGCCVAAGLDCTPFLCVGPDEAFFATPFYFNAGVLLFDLENCRTYGLQER
CQKVLQHRGRKLRYCDQTMLNLAIPPRRVARLPLRYNWPAGISDAALRSVAWCNREDKPT
FSREAFFEERAQVRLLHFIGGPLPTKPWYPQCTSPWKAYYLQNRVHTPWGEDPLPDGRPK
NAWEAFVRGFSYLWDTRLSAIPAFLYRSLHGKRKNPFVEK

Enzyme Prediction     

No EC number prediction in MGYG000001069_01763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	268	2.3e-40	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	4.19e-45	6	268	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	5.92e-31	4	296	1	273	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	6.89e-29	7	268	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
PRK15171	PRK15171	1.14e-12	2	302	22	302	lipopolysaccharide 3-alpha-galactosyltransferase.
cd02537	GT8_Glycogenin	1.17e-12	45	289	39	233	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18312.1	1.61e-122	6	331	1	326
ARP50963.1	1.62e-115	6	331	24	348
QKN23309.1	1.62e-115	6	331	24	348
QKO30010.1	1.62e-115	6	331	24	348
QLQ62775.1	5.45e-24	7	294	6	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	1.43e-09	6	278	1	261	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.92e-09	7	278	2	261	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19817	7.53e-15	2	332	22	336	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P19816	4.21e-12	2	294	24	298	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27129	6.11e-11	6	298	28	302	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
Q9LHD2	1.35e-07	2	173	67	249	Probable galacturonosyltransferase-like 10 OS=Arabidopsis thaliana OX=3702 GN=GATL10 PE=2 SV=1
A0A0H2URA3	1.98e-07	4	226	2	204	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001069_01763.