CAZyme Information: MGYG000001070_00382

Basic Information

• Species: F0422 sp900544365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp900544365
• CAZyme ID: MGYG000001070_00382
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	MGYG000001070_12|CGC1	21458.33	4.947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001070	1755005	MAG	Sweden	Europe

• Gene Location: Start: 5540; End: 6103 Strand: +

Full Sequence      

MRVSTAFAWLIVVLTAYYVQYGQPYLARQYAYPLVYESAVMKNASTYHVRPSMVAAVIYT
ESKFDTNAKSLPGAIGLMQLMPDTAHWIGEQLNQSSLSDQDIKEPNTNIQLGTWYLSYLL
EEFKGNEILALAAYNAGRGHVEAWMQTYGWDDNFDDVDKIPFPETKDYVKRVMAHEAQYQ
LLYSQLR

Enzyme Prediction     

No EC number prediction in MGYG000001070_00382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	41	178	3.2e-32	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.07e-77	33	173	1	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.60e-59	31	182	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.28e-38	51	175	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	8.25e-34	5	185	113	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.97e-32	42	150	3	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARF99123.1	6.49e-59	1	185	1	182
SNV63004.1	1.85e-58	1	183	1	180
CAB1276067.1	1.85e-58	1	183	1	180
ACZ24461.1	1.51e-57	1	183	1	180
QQB16279.1	1.51e-57	1	183	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	5.27e-24	32	180	449	599	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	5.27e-24	32	180	449	599	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6FBT_A	6.20e-23	32	179	445	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.34e-23	32	179	474	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	1.11e-22	36	183	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.94e-23	32	180	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.94e-23	32	180	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	7.43e-23	32	180	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.12e-20	37	174	61	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.64e-20	36	175	1422	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.610382	0.387401	0.001105	0.000284	0.000235	0.000599

TMHMM  Annotations     

start	end
5	27