CAZyme Information: MGYG000001070_01272

Basic Information

• Species: F0422 sp900544365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp900544365
• CAZyme ID: MGYG000001070_01272
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		55951.87	9.4054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001070	1755005	MAG	Sweden	Europe

• Gene Location: Start: 11163; End: 12626 Strand: +

Full Sequence      

MKHLHFMKHMVLGISVFSLAASYQVAEATIHIPFPALSNTTTVAPTQYVGPMLHVPEKQE
VTLPITMVFDPIVSETAYDTKYVHNGTSIMSPSWFELTTSGLKASSKLSHDYVNSYKEKG
YRVWPLITNQFDPDMTSKILANESMWERYKQGLINYATEYGYDGYNFDFENVHYKDKAQL
TKFVDFLAKGLRDYNLHSSIDVTGYSNSENWSLVYDRKAYADSVDYVVLMAYDETWASSD
TAGPVASYPWVRKHTEKMISEVPSSKLVLGVPFYMREWAVPVKGDWEGKAKSKTLSMTKA
LDLEREYRDVMRWDDRLKGNYLTLTNKNGVYGIYDEKKPYEGTLTKIWFEDPQSLGYKVS
LVKELQLAGVAAWRKGFESKDIWPVLSLALDGANSVEKEQALLETKTQKIETEKENKKQE
KQKDKKKGKKKDKKKHKKKSKHTEESEITKFSKDGKEIVLKFKKQDKQPEETETVIVTKE
KKPLPKG

Enzyme Prediction     

No EC number prediction in MGYG000001070_01272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	112	379	1.2e-35	0.7804054054054054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.04e-70	81	386	21	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	8.32e-43	111	387	151	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	4.30e-21	137	373	80	302	Glycosyl hydrolases family 18.
cd06549	GH18_trifunctional	2.98e-20	88	383	25	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.37e-19	112	373	56	329	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV65543.1	2.84e-118	55	380	121	428
BBU34423.1	4.13e-118	64	380	130	428
BBU36194.1	1.07e-117	64	380	130	428
VEG93546.1	2.32e-117	64	380	130	428
CAB1275696.1	1.46e-115	64	378	130	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	4.05e-23	131	383	182	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.30e-22	126	386	172	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	3.03e-19	122	374	66	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	1.67e-16	90	387	37	345	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
5JH8_A	2.32e-15	153	390	96	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	6.15e-26	117	386	81	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	5.15e-22	126	386	171	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	5.60e-21	126	386	171	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	4.76e-19	127	387	173	420	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	5.89e-19	122	374	158	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000691	0.998307	0.000289	0.000257	0.000222	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001070_01272.