CAZyme Information: MGYG000001071_00828

Basic Information

• Species: Haemophilus_A sputorum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A sputorum
• CAZyme ID: MGYG000001071_00828
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		38454.62	8.9538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001071	1444895	MAG	Sweden	Europe

• Gene Location: Start: 110; End: 1150 Strand: -

Full Sequence      

MNILVISPSWVGDMMMSNALYQQLKTNYPDCEIDVMAPDWCRPLLARMPQVRNAISMPIG
HGAFRLAERYRLGKALRNQYDLAIVLPNSLKSALIPFFAKIPKRRGWKGESRYGLLNDLR
TNKNDYPMMVQRYVALAFEKGQVPSAENLQIAFPYLQTQAVEIAATKAKFETALKQTENR
AVIGFCPGAEFGPAKRWPHYHYAKLAEMLIEKGYAIYLFGSKKDQEVGEQIRQSMPESLQ
PYCLNLAGLTDLNQAVDLIAECTAVVSNDSGLMHIAAALNKPLVALYGPTSPTYTPPLSS
NAQVIRLIEGGLIKIRKGEGAEGYHQSMIDITPDSVLAALKNFGIN

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	306	7.9e-57	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10916	PRK10916	0.0	1	340	1	339	ADP-heptose--LPS heptosyltransferase RfaF.
TIGR02195	heptsyl_trn_II	6.46e-179	2	341	1	330	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0859	RfaF	1.23e-104	1	343	2	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.37e-90	69	325	1	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	2.93e-89	2	342	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP12282.1	4.33e-209	1	340	1	340
QEN11086.1	4.33e-209	1	340	1	340
AHG72497.1	3.31e-203	1	341	9	349
QNS15356.1	3.50e-203	1	341	1	341
AWW33463.1	3.50e-203	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	2.09e-133	3	341	3	340	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	2.24e-11	177	341	182	342	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	3.02e-07	1	306	1	298	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	3.02e-07	1	306	1	298	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	3.10e-07	1	306	1	298	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	4.28e-182	1	341	1	341	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	4.44e-142	1	341	1	340	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	7.29e-141	1	342	1	341	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
Q9R9D5	1.22e-09	12	301	5	290	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.72e-08	12	341	5	328	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001071_00828.