CAZyme Information: MGYG000001072_02372

Basic Information

• Species: CAG-317 sp900543415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-317; CAG-317 sp900543415
• CAZyme ID: MGYG000001072_02372
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001072_109|CGC1	36682.88	5.9772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001072	2601066	MAG	Sweden	Europe

• Gene Location: Start: 11242; End: 12216 Strand: -

Full Sequence      

MVKGEQKIGGTKWYLDEKTGALYTGWRVVDNKWYYHNNYGYKTIGWQKIDGHWYYLNGSG
EMLTGWQYIGNHWYYLNGSGVMLTGWQYIGNKWYYLETSGIWNSNPTSKPPVQDDSSGKP
TNKPSPSPEEKPSVENYYTIEGESTVTVEQMARWYTENSPITFPVDSYHSGGVNSLEEFC
KIYCEEAQSENIRVEVAFAQAMHETGWLQFEGQVKIGQFNFAGLGATDGGASGADFSKYG
TEGVRMGIRAQIQHLKAYASDTITEKTLANLCVDERFKYVTKGCAKYVEWLGQKENPQGL
GWATAEGYGNKIRDQIDRLKACKV

Enzyme Prediction     

No EC number prediction in MGYG000001072_02372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	180	318	2.5e-19	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	3.18e-27	1	100	521	619	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.72e-25	1	100	481	579	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033840	PspC_relate_1	1.76e-25	13	105	519	611	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033840	PspC_relate_1	1.38e-24	1	100	528	627	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033930	pneumo_PspA	1.86e-24	1	100	501	599	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL26238.1	4.24e-59	134	321	78	255
QHB24702.1	7.17e-59	134	320	82	258
QEI32209.1	7.17e-59	134	320	82	258
QRT30849.1	7.17e-59	134	320	82	258
CBL25595.1	2.68e-56	138	319	87	258

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	6.48e-14	174	313	66	189	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996765	0.003116	0.000098	0.000008	0.000005	0.000026

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001072_02372.