CAZyme Information: MGYG000001073_00886

Basic Information

• Species: Fusobacterium_B sp900554885
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900554885
• CAZyme ID: MGYG000001073_00886
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702		77285.58	4.5681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001073	2595353	MAG	Sweden	Europe

• Gene Location: Start: 316; End: 2424 Strand: +

Full Sequence      

MKKLTLLTLFCALATGAMAGDGWNEGMNIFKGNANKGETGYRIPAITATSQGTLVAVSDI
RYDNRDMPGRCEFIIKTSDDGGSTWNEESIIAPKGGITDPSIVHDPTTGKTFLFGYQNTS
GIVGKDGKFSFMVYTSEDGGKTWDDGNTLATNKNGQNEGLIPDNYKYMLQGPGNGMVYNG
TIYMPIQTWHNTDKPLQGVDHKNDGTSGYIYSEDGGKTWKLSGLLRPEGVDVTSESSVFH
HNGKIYLAAKAEVGHADAESGKDKRRVVYCTSDNGQTWEKVEEDFIPKDAAMCETSTLAL
NDQVYVVGYAIQDQELGGYNREDMYITTNTGRKVKVFEGKTLGYTSLAQDQDNLYVLYEG
NKANSDIDMRRFDIASKEYTNLNAQILDRGQSLLDVQGKLSSDQYVGGTYTNESESGAEA
VVELNNFKIGAFHRNTKDNSDDVYRTIPYNLKETTLVLSQDNAFMQGDNIFAGYQAGKIE
YSNKSTNDLTSFVMGYTFNKELENDKTYIFALNGVYSNNKVERNKAEGVGRTAEFDSYSI
SMKNALSKNISFTDSSNLKLTAGLNTTVFGHDGFEEDGGLPEIDGKKFNNATVDKSQNVS
NEIFAKATLDQRVKLTDKSSVRLALDLGWEKELMDVDEWRDEFTVLDVEKEFATPVKKHE
GGLGKAEVSATFDLAEKVELGVGYSMDTDGESTATGKVTYKL

Enzyme Prediction     

No EC number prediction in MGYG000001073_00886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	32	371	1e-51	0.9649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.57e-45	41	373	14	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13859	BNR_3	2.60e-10	52	279	9	212	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	2.29e-08	75	282	20	202	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
smart00869	Autotransporter	1.74e-06	429	693	4	266	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type IV pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different peptidase is used and in some cases no cleavage occurs.
pfam03797	Autotransporter	1.41e-05	470	685	44	254	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM15078.1	8.32e-235	1	702	1	715
AMZ14174.1	5.90e-180	21	700	8	677
AVQ18134.1	3.73e-168	231	702	8	464
QPR26713.1	1.85e-161	21	700	32	701
ASG76455.1	7.22e-161	97	700	37	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	1.96e-18	37	363	177	508	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	2.17e-18	37	363	198	529	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4FJ6_A	2.57e-18	37	363	177	508	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
4Q6K_A	1.87e-17	37	363	180	511	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
1EUR_A	2.88e-15	33	284	17	260	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.25e-19	41	363	203	530	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P15698	1.61e-15	29	279	41	283	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
Q02834	4.87e-14	33	284	59	302	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P10481	1.83e-12	41	282	36	268	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P29768	1.01e-10	28	379	22	381	Sialidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nanH PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000299	0.998806	0.000274	0.000199	0.000192	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001073_00886.