CAZyme Information: MGYG000001073_02444

Basic Information

• Species: Fusobacterium_B sp900554885
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900554885
• CAZyme ID: MGYG000001073_02444
• CAZy Family: GT4
• CAZyme Description: N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
143		16195.11	9.0214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001073	2595353	MAG	Sweden	Europe

• Gene Location: Start: 1061; End: 1492 Strand: +

Full Sequence      

MGGGHKLYIVGNGPDSEKIKDVINKNGLEKQIILLGQKRNPYVWMKNAKLFVHSSFYEGF
GLVLVEAMICGKVVLSSDCPVGPKEILSKENCGVLFKTGDVIDFSKKLLELANKDLSLYQ
EKIKNRIEEFKIEKIMKEYEKII

Enzyme Prediction     

No EC number prediction in MGYG000001073_02444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	6	115	4e-29	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	8.55e-37	6	135	221	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	1.82e-35	6	141	214	351	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam13692	Glyco_trans_1_4	1.44e-25	6	111	35	135	Glycosyl transferases group 1.
pfam00534	Glycos_transf_1	3.82e-24	6	111	35	141	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	7.72e-24	6	143	232	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQJ09807.1	2.32e-43	6	143	253	392
AVQ27014.1	2.32e-43	6	143	253	392
BBA50406.1	2.70e-41	6	143	253	392
AVQ17415.1	9.76e-39	7	143	255	393
AYV92469.1	4.59e-38	6	142	254	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4X6L_A	1.94e-16	6	139	351	487	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X7M_A	1.94e-16	6	139	351	487	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4WAC_A	1.95e-16	6	139	356	492	CrystalStructure of TarM [Staphylococcus aureus],4WAD_A Crystal Structure of TarM with UDP-GlcNAc [Staphylococcus aureus]
5N7Z_A	2.03e-13	6	130	212	340	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	2.03e-13	6	130	213	341	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58459	1.91e-16	6	90	235	319	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
A0A0H2WWV6	1.06e-15	6	139	351	487	Poly(ribitol-phosphate) alpha-N-acetylglucosaminyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=tarM PE=1 SV=1
Q0P9C7	1.71e-13	6	138	224	358	N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglJ PE=1 SV=1
Q06994	1.11e-12	6	130	212	340	Lipopolysaccharide 1,6-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaB PE=1 SV=2
P27127	2.08e-12	3	143	207	351	Lipopolysaccharide 1,6-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001073_02444.