CAZyme Information: MGYG000001074_00269

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_00269
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43487.64	9.3478

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 108; End: 1238 Strand: +

Full Sequence      

MKKTLIIALAFLGMQSASAKDWTVTEVKTIITKVNDTWQQNHPKQERSFWDPAVYHTGNM
EAAKYMNNRKWYQYSYDWAEQNLWQGARETDNTKWKYKTYGEGHQFVLFGDWQICFQTYI
DLYNSPLAPADKEFMVKRAKEVMGFEAYSDASDYWWWADALYMVMPVMTKMYKLTGDKQY
LTKMHDNWLYANSIMYDKKTGLYFRDGKYVFPKHTTAAGKKDFWARGDGWVVAAFAKILQ
DLPKDDANRKEYIKYYKKIVKGVAACQQAEGYWTRSMMDAEQAPGRETSGTALFAYGIQW
GINNGILSKKYQKVVDKAWEYLATIALQPDGTVGYVQPIGEKAIPGQVVNQKSVTNFGTG
AFLLAACEYARHLEKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	371	1.2e-75	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.48e-88	22	373	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.26e-38	114	371	83	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28481.1	4.44e-178	1	375	1	380
ADE82673.1	1.49e-169	1	375	1	371
QVJ79822.1	2.11e-169	1	375	1	371
QUU00388.1	5.87e-163	6	374	8	373
QUT64861.1	1.18e-162	6	374	8	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.89e-161	26	374	32	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.12e-138	23	374	12	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	5.31e-47	27	368	29	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.31e-16	148	368	132	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.79e-15	148	368	122	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.31e-47	1	368	1	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	4.24e-43	155	368	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	4.28e-40	155	368	157	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O34559	2.36e-15	148	368	132	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998979	0.000190	0.000165	0.000151	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_00269.