CAZyme Information: MGYG000001074_00638

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_00638
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		91149.44	6.9862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 17; End: 2467 Strand: +

Full Sequence      

MMAGMVLLAANAQVKGNAGYPISPVPFTSVKVVENSFWGQRLEASRNVTIPLAFSKCESE
GRYKNFERAVHPSDDYNVTKLMPFSFDDTDPYKTIEGASYILQTYPDAKLKAYIDSVLDI
IAPAQEPDGYLYTARTMNPKHPHNWAGKERWSKEEDLSHELYNLGHMVEGAVAHYQATGS
RKFLDIAIRYADCVVKEVGDKPGQACVVPGHQIAEMALCRLYLATGNRKYLDEAKFFLDY
RGKTSIKQEYSQSHKPVVDQDEAVGHAVRAAYMYAGMADVAALTGDSAYIHAIDNIWDNI
VCKKLYITGGIGATASGEAFGPNYYLPNMSAYCETCAAIGNVYVNYRLFLLHGESKYYDV
LERSLYNGLISGVSLDGGGFFYPNPLESMGQHQRQPWFGCACCPSNICRFIPSLPGYVYA
VKDRNVYVNLFLSNSSTLKVAGKDVALTQATEYPYDGDVRLTINKNSAGQFALKIRVPGW
VKNKPVPSDLYSYSDNKRLGYYISVNGTEIGADNGCITEDGYFTITRKWKKNDVVKIHFD
MEPRTVRANNLVEEDRGMVEIERGPLVYCAEWPDNKFDIKNIIINQNPKFDIAEQTLDAF
IPEASKQKLTAYKGMRIKTLSTNAQTLAFDKAGRLATTDVKLTLIPYYAWCHRGNGDMKV
WLAQDLKATRPAEPATLASTSKVASSMNIPALSSINDRLVPKDGSDRSIPYAHWWPKKAS
TEWISYDFEKEAKVQSCTVYWFDDQPWGGCSVPKSWKVYYKDNSGNWIPVEGADAYPLAK
GTACTVNFEPVTTKALKLEVTLPDNLSAGIFEWSVR

Enzyme Prediction     

No EC number prediction in MGYG000001074_00638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	33	569	8.8e-199	0.9942748091603053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	29	569	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.34e-163	24	665	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	0.001	175	296	99	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
pfam17132	Glyco_hydro_106	0.005	671	803	163	287	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84571.1	0.0	2	816	10	822
AGB29922.1	0.0	2	816	5	816
ADE82616.1	0.0	6	816	13	811
QJR57394.1	0.0	11	816	18	801
QJR78977.1	0.0	11	816	18	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	17	669	2	630	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.55e-132	33	662	18	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.76e-127	33	662	18	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.72e-100	35	662	48	694	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.02e-99	86	661	73	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.57e-99	86	661	73	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.976525	0.023301	0.000103	0.000049	0.000025	0.000042

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_00638.