CAZyme Information: MGYG000001074_01613

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_01613
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33969.33	6.1631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 43; End: 954 Strand: +

Full Sequence      

MVNPGVDDMWFHWIVAENPGAKEYIDGFFKHYKELGVEFIRMDFLSWYEDGKDRGIGVVG
RGYGRESYARAMAYIGEAAKKYGIFTSLVMPHNFNDAEIEARYGNMMRIVCDTGGGGWWH
TSAQDKGKSYASWPQCMNQFDGFTYWSHLSGRNKIILDGDFIRLNKFDTDAERETVISLQ
LMAGGPVAAADQYTTIGNNLKFYVNDELLALNKDGFVGKPLSDKLGDKKNEIWYGKMTNG
DYVVGLFNRSDNTASVSVKLSDIGISGEKNVRDLWKHTDEGKVSVLSANIPAHGCKIVKL
SDQ

Enzyme Prediction     

No EC number prediction in MGYG000001074_01613.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	30	280	4.1e-33	0.9344978165938864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	9.00e-18	231	300	5	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02808	PLN02808	4.83e-10	205	303	286	386	alpha-galactosidase
PLN02229	PLN02229	7.73e-10	205	303	316	420	alpha-galactosidase
cd14792	GH27	1.14e-06	16	214	96	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02692	PLN02692	9.90e-06	205	300	310	408	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67171.1	1.25e-173	3	300	176	473
QUT44530.1	2.51e-138	1	301	184	491
QUT79686.1	2.51e-138	1	301	184	491
QRM98947.1	2.51e-138	1	301	184	491
QUU07210.1	1.01e-137	1	301	184	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	2.52e-74	12	301	170	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	3.42e-74	12	301	196	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1
P14749	1.89e-09	181	303	291	410	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1
Q42656	1.01e-08	169	303	241	378	Alpha-galactosidase OS=Coffea arabica OX=13443 PE=1 SV=1
Q99172	5.18e-06	169	294	271	417	Alpha-galactosidase OS=Lachancea cidri OX=29831 GN=MEL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_01613.