CAZyme Information: MGYG000001074_01693

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_01693
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43317.28	8.4233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 2591; End: 3751 Strand: -

Full Sequence      

MALLALMACDRQRNVETTPWGSVVSSDSVMLNGNSFTLDDIQANGELIVLTMTGPDNYYD
YHGRGLGTQYLLAEKFAQSLGVSLRVELCRDTAEMVSRLHAGDGDIIACLLPKGMKGMTA
AGVCNEAKSCSWYVDEGNGELATALNKWFDRKLVAKIRKEEDMLFSKKAVTRRVYSPMLN
RAGGVISHYDRYFQQYAPLARWDWRLVAAQCYQESTFDPQARSWAGACGLMQIMPKTAEY
LGLPMGDIFNPEKNIEAACRYLAELNGKLSDVRDRQERVNFVLASYNGGILHIRDAMALA
EKNGKNKHRWAEVSQYVLGLAKPQYYNDPVVKYGYMRGSETVDYVQRINARYDEYRGVAR
GTGGFTPFGGGTQSPRKSERKNRFEV

Enzyme Prediction     

No EC number prediction in MGYG000001074_01693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	201	355	1.3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	9.60e-76	193	356	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	5.47e-46	37	353	35	448	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.03e-43	38	357	16	433	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	5.02e-23	203	308	11	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	8.28e-23	188	317	3	137	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	5.59e-165	3	386	11	391
EFC70077.2	1.65e-164	4	386	13	391
VEH15587.1	8.09e-158	1	386	40	433
BCS86517.1	3.46e-156	8	386	9	390
AGB28026.1	1.09e-155	4	386	36	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.33e-26	186	353	256	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.44e-26	186	353	263	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.44e-26	186	353	263	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	1.68e-26	186	353	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.68e-26	186	353	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.14e-30	68	353	155	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A1U3J1	1.73e-29	37	353	32	446	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A8AD27	1.10e-27	41	348	39	444	Membrane-bound lytic murein transglycosylase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltF PE=3 SV=1
Q02RN8	5.77e-27	91	353	181	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
Q8XA45	9.75e-27	41	348	39	444	Membrane-bound lytic murein transglycosylase F OS=Escherichia coli O157:H7 OX=83334 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000007	1.000040	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_01693.