CAZyme Information: MGYG000001076_00261

Basic Information

• Species: CAG-411 sp000437275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-411; CAG-411 sp000437275
• CAZyme ID: MGYG000001076_00261
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987		108958.78	6.3853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001076	3627630	MAG	Sweden	Europe

• Gene Location: Start: 65570; End: 68533 Strand: +

Full Sequence      

MKHGVAKRALGVVMTSAMVAGTVGTVPLGNWNKSAVDTVLAAGQSAMYVDSTDYYNAAYD
KENAYTGDDLGCTYTKEKTVFKVWSPEADKMTLNLYATGSDKEEGAKDLGNFSMKKTDKG
VWEYTYEGDLKNTYYTYRAMIDGMSYGETVDPYAKAAGVNGERGMVVDLDSTDPSGWDTN
YKRTATNLSDIVVWEVHIRDFSIDVSSGVSAENRGKYKAFTESTTVNGEGKVSSCVDYLK
KMGVTHVQLLPMFDYGGIDETKTTNELSDSNYNWGYNPVNYNVPEGSYSSNPYDGNTRIK
EMKQMIQALHDAGIKVIMDVVYNHTYETGTSCFSKLMPDYYYKLTTDSAGNVVYNDESGC
GNATRSGAAMYDKYMRDSLKYWVSEYNIDGFRFDLMGIHDAKTMNNIRKDMDDNFGNDTI
VLYGEGWTGGGYSKDSAYKEYCRNLDEGIGYFNDQIRDAIKGETGNEKVSQIGFAQQNYG
LDGTYTDHEKFPTSVFGGIMGSVGKNTSNWWMWRAYWADTSNRVLSYDSCHDNMTVWDKF
VQSMGVKDFSTTDNRLLNMSRMTAGYLLTSHGGTFLHAGEEFARTKNGNENSYNAGDSDN
KLDWNRISSYGNLTDYYQGMIAIRKAFSGFRNILTETGDVVEENTASGFFNKVNGNNITN
IPEFTEVVEGKNENNQIQSTVNSIGYYLSNDVANEWNQVAVLMNNTTTAKTAQLTATDGS
QEWVLVSDGKQASVTGIATSSGSAITVPGKSVVVAVPKKAFDSVKFTGEDKIIPITEEDK
DEPIVSPEPTKEPEVTPAPVTPSAIKISKFTVTPTTVKNGSGTVKMSVKMAASTTDACEY
RFYVYKGDVLVKSSAWSEKDNFEWKATKAGTYTIVVRVRDTAGNMVSAEKTVSVFDKLTV
KSVKADKKVVKKGKNITFTVKATGGKTAYKYSFKVVKTSGKIVKKSNTISSGKWIWKATQ
KGTYNVKVTVKDKFGATVTKTIKIVVK

Enzyme Prediction     

EC	3.2.1.1	3.2.1.41

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	237	581	1.7e-96	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	0.0	59	732	1	601	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	0.0	190	624	2	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	2.06e-118	80	754	70	688	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PLN02877	PLN02877	2.06e-97	64	604	210	797	alpha-amylase/limit dextrinase
TIGR02102	pullulan_Gpos	7.37e-84	60	835	310	1072	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT05892.1	3.80e-173	52	781	34	729
QCT07019.1	4.59e-168	8	762	15	711
QCT07748.1	3.48e-165	45	763	22	704
APO32485.1	1.51e-160	52	775	21	686
QCT05893.1	5.51e-160	55	773	35	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	8.13e-179	7	763	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	1.26e-177	7	763	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	1.34e-177	7	763	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	1.38e-177	7	763	5	719	ChainA, Pullulanase [Ruminococcus bromii]
2WAN_A	2.73e-127	65	731	313	896	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	5.25e-106	53	631	218	752	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	3.80e-105	57	631	94	620	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
Q8GTR4	2.00e-66	70	609	208	795	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
A0A0H2ZL64	9.83e-59	60	631	427	1020	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
A0A0H2UNG0	1.03e-58	60	631	442	1035	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.076858	0.907515	0.007145	0.007436	0.000692	0.000314

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001076_00261.