CAZyme Information: MGYG000001076_00262

Basic Information

• Species: CAG-411 sp000437275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-411; CAG-411 sp000437275
• CAZyme ID: MGYG000001076_00262
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1410		153766.26	5.4084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001076	3627630	MAG	Sweden	Europe

• Gene Location: Start: 68747; End: 72979 Strand: +

Full Sequence      

MARYSLKKRLFSVAMAAVLTTSTIYVMPSVTVKAEKGEGTVKAKRSFDSNYDAQNAYSGD
DLGCTYTKEKTTFKVWSPLATKVVLCRYEKGNGGSVIEEKDMTKGDKGVWSITIDGDIVN
TYYTYKVTANGETKEAVDIYAKAAGVNGQRAMVVDLDSTDPANWDKNYKREKTLLSDIDV
WEVHVRDFSIDVSSGVSKENRGKYKAFTESTTVNGEGKVASCVDYLKELGVTHVQIMPMY
DYASVDETKVTSDLGSNYNWGYDPLNYNVPEGSYSSNPYDGNVRITEMKEMIQALHDAGI
KVIMDVVYNHTYDTADSNFNKIMPDYYYKLNSDLTYNNQSGCGNATRSDSAMYRKFMIDS
ISYWADEYNLDGFRFDLMGIHDVTTMNQIRKTLDEKFGEDTIVLYGEGWTGDGNYDSNSA
HKANESQLDDGIGYFNDQIRDAIKGEHKFDGTIGLVQTNYTTGDYLEPGEKWPNNVFGGI
MGSVGKTSGTWGMWRPFWSKSSNCSLSYTSAHDNLTLWDKLTEKFGKQYDSTDDKLLRMN
KMAGATVLVSKGGAFMQAGEEFARTKHGDDNSYKSADSVNKIDWNRLNTHENIWKYYEGM
LSIRQAFSGFTQITTRSGDNWHPNNNNLEWIAQDVYGVSAFTETNNVKGEWDRVAVIINN
KTTDATVDLSKYSSKWVVIADGNTAGLTKISECDGSVKAAGKSVVVAVPKDTFDANPDVG
NRNTAPTISIAQTSIETTPGQKVEFEVKASDKDGDTVTLTASGLPEGATFENGTFTWESA
KKGEYTVTFTASDGKDKTTKTVTIKVTSASEALEKLIAEVEAAGLSKDDYTENVWNALQN
ALEQAKQVTAKEDASQEEITNAVTTLQNAYDAVLAEKEAREGLQTYVKEAETTIAAANES
NDASIISDAKTVLEEAKTLLDGVATKEAYNVAKSNLEDSVNALVVGSGKTSLHVSASAFS
KVYAYAWTGTGTSAEKLLGAWPGKQLTEKDSDGNYVIELDDVAADSKFNLIINDGSTSQT
KDIEDVSGKVTVTVDATSSGTQNGNKVYNAKATSEPVSATTPEITKKSLQAVIKDAETYK
EEDYTEESYAVLKEAIETASKVNDKESATQLEINQTTRVLRAAILNIVKKQGNVVEPTPA
ATASTEPTAEATSTPQPNQSSAPDSSSAPEQSSTPSPTDVQNTPEATTNPTNPVETVQPG
IDDATAAPSVTATVAPTASPAVESDFKISSVKFSPRLCQVVNKNIILSVAAKGGVGTYKY
KYEVYLGSKQVLAKNYGSSRTLKYKPTKAGTYRFKVSAMDEDGVVRTVTKSYVVVSKKLA
ISSVKIGKATVKKNSKVKFTVKAVGGKKAYKYNFTIINAKGKTVKKSGYTTKTSWNWKAK
TTGTFRIKFTVKDATGTVVTKTVKKVKVVR

Enzyme Prediction     

No EC number prediction in MGYG000001076_00262.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	224	561	4.8e-104	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	0.0	46	689	1	605	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	0.0	177	604	2	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	2.97e-127	72	706	70	688	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02103	pullul_strch	9.86e-109	52	594	116	735	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	1.44e-104	56	590	210	802	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT05892.1	4.71e-186	8	1028	2	1015
QCT05893.1	1.14e-185	54	762	41	724
APO32485.1	4.46e-183	40	715	19	674
QCT07019.1	7.95e-178	13	714	20	711
QCT07748.1	4.26e-165	29	772	20	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	3.34e-179	8	715	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	4.96e-178	8	715	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	5.27e-178	8	715	5	719	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	5.44e-178	8	715	5	719	ChainA, Pullulanase [Ruminococcus bromii]
2WAN_A	1.95e-135	57	706	313	918	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0SPA0	4.44e-107	39	610	88	619	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
O33840	9.36e-106	57	698	220	831	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
Q8GTR4	1.48e-63	56	584	203	790	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
A0A0H2ZL64	2.25e-62	52	695	427	1105	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
A0A0H2UNG0	5.63e-62	31	610	424	1034	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000681	0.998518	0.000197	0.000233	0.000182	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001076_00262.