CAZyme Information: MGYG000001076_01184

Basic Information

• Species: CAG-411 sp000437275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-411; CAG-411 sp000437275
• CAZyme ID: MGYG000001076_01184
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MGYG000001076_122|CGC1	34561.95	8.2003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001076	3627630	MAG	Sweden	Europe

• Gene Location: Start: 11519; End: 12415 Strand: +

Full Sequence      

MADNIIKKVRHFFYCIVWIGKDKITKPFIGQPQIKSVEETYEKILTDHVSVSRFGDGEFK
WMADLPQNTFQNPSKEMQQRLIEISKSDLENHIVCLSDTFGDLKQFNAYGREFWGCFMGM
YRKKWMRFLKPGKVYYNTNMTRPYMDYVDKSPCAMRFAMLKKIWQDRKVVLIEGEKSRLG
VGNDLFSTAASVQRILAPATNAFDKYKELLTRACQLEKDTLILIALGPTATILAYDLAKC
GYQALDIGHVDVEYEWFQMGATSKVPLKNKYVNESLQGRNIGELQDEEYISQIIDRIE

Enzyme Prediction     

No EC number prediction in MGYG000001076_01184.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	51	274	6.4e-86	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08759	GT-D	4.21e-134	52	274	1	222	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.
TIGR03728	glyco_access_1	3.24e-112	34	298	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK61699.1	4.26e-93	32	294	37	297
QIK56277.1	4.26e-93	32	294	37	297
QQA15849.1	4.96e-91	19	293	30	303
QWI40596.1	4.96e-91	19	293	30	303
AJH18501.1	4.96e-91	19	293	30	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	1.61e-58	29	297	9	276	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	1.61e-58	29	297	9	276	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	2.84e-56	29	297	9	276	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	2.91e-55	31	294	5	268	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URB1	1.51e-53	19	297	536	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1
Q9AEU2	5.66e-53	19	294	402	676	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001076_01184.