CAZyme Information: MGYG000001077_01910

Basic Information

• Species: Limosilactobacillus oris
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus oris
• CAZyme ID: MGYG000001077_01910
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		41272.79	7.5717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001077	2006111	MAG	Sweden	Europe

• Gene Location: Start: 6146; End: 7276 Strand: -

Full Sequence      

MNKQLLTVIIAGMLSFTNGAPVLAAGINVNSAYQDAESVIINQQQLDEGQIRQRGEEYTS
AFLTAFAQLSRDYEQSFRQGVADGLRGIIDGRTRTKVGQAGYQRGYQRGQQLRPQPVPAS
PSSPSAAPTDNTTPPADQPAQPDQSPAATGPDQQEYEVQSPSPDQAKFISRIAKSAQKVG
MEYDLYPSVIIAQAALESNWGSSGLAQKPYHNLFGVKGSFNGKSVVQPTTEYTHDGEEKK
INDHFRWYENDYQSLCDYAETLADPLYAGVHRGQAGSYRAATHSLLGRYATDPQYDRKLN
KIIASYQLTKYDDPVPTGKNDHDNRELPKQESVAAVRDPQSHVSRKKTHHLTWLSIVGGA
SSAGALGLLRRFLIKS

Enzyme Prediction     

No EC number prediction in MGYG000001077_01910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	173	308	9.7e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.30e-55	144	321	22	197	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.21e-42	162	314	317	474	amidase domain-containing protein.
PRK06347	PRK06347	2.23e-36	129	320	101	311	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	5.44e-32	166	312	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	6.67e-25	110	305	95	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN92542.1	2.20e-113	1	374	1	362
QFV01117.1	3.81e-83	1	375	3	382
QFS34532.1	2.69e-78	1	375	1	351
QFG72894.1	3.59e-71	152	375	2	223
QDR72191.1	2.89e-64	152	375	117	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.30e-36	165	312	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.97e-32	162	313	57	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.68e-16	164	303	2	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.35e-16	164	303	2	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	7.57e-15	173	308	13	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CIT4	3.28e-33	158	312	55	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.16e-32	158	312	55	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	1.54e-32	154	318	169	339	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	7.86e-32	166	314	63	216	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	8.00e-32	158	312	55	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001158	0.997423	0.000327	0.000396	0.000338	0.000305

TMHMM  Annotations     

start	end
5	27