CAZyme Information: MGYG000001078_00103

Basic Information

• Species: Rothia sp001808955
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia sp001808955
• CAZyme ID: MGYG000001078_00103
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		46036.87	5.973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001078	1984981	MAG	Sweden	Europe

• Gene Location: Start: 3402; End: 4664 Strand: +

Full Sequence      

MNSQPSSHNAQSLESISEYAERTSSHAAAAAASVTDTFVHRILGVPGALIGSVQVPDPRP
LSQRLNAWHYWWQAHLLDCVIDAGQRRLREGDITAAQEELHRARALLRGINVRNYGRFAN
DYFDDMAWLTLAVGRMNSFCIELTAANDVAAQDAGAALFEQLAKGFSPVGGMSWRKSKRD
FVNAAATAPTALAYVRAGDPKTAAALMDWMNETLWDAERSLYIDGVNVRGDEYEYERGEF
TYNQGTALGALLSLAASGVPCEVDPAERAERLIVGIVKHMTEEVEFLSGARRRILISHGD
GDGGLFTGILVRYLGMAASSPLLSDEARALASNLVYSTARALWEGRREFDPNLPMNEYGI
DPNEIRGKALVQFSPRFTEPMSKVVKPGAPVELSTQVQAWTIFETAARLAHARHLASHSF

Enzyme Prediction     

No EC number prediction in MGYG000001078_00103.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	64	351	1.3e-56	0.7625698324022346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.72e-42	34	407	10	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW99112.1	5.93e-299	1	420	1	420
ATF62942.1	3.43e-298	1	420	1	420
BAI65589.1	2.17e-297	1	420	78	497
BAS19786.1	4.47e-294	1	420	1	420
BAV86349.1	1.91e-150	33	409	31	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.92e-27	68	409	86	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	6.80e-26	68	409	87	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.41e-25	68	409	87	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	2.39e-14	66	347	41	303	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001078_00103.