CAZyme Information: MGYG000001080_00652

Basic Information

• Species: Staphylococcus haemolyticus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus_A
• CAZyme ID: MGYG000001080_00652
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		28676.42	9.2002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001080	1416081	MAG	Sweden	Europe

• Gene Location: Start: 1023; End: 1841 Strand: +

Full Sequence      

MKKLAVAASVATGAVAVLSNHNAEASTQHTVKSGESLWSIASKYNTSVDSIKKSNNLSNN
MIFPGQVITIGGSSNNANNASSNATTSSSYYTVKSGDSLYAIASKNGVSVNALMKANNLS
GYLITPNQQLKIPNGSANTPTETNPNTTNNGGGSGGYASPSFNHQNLYTAGQCTWYVFDR
RAQAGKPISTYWSDAKYWAGNAAADGYTVDHNATVGSIMQSTTGYYGHVAYVERVNADGS
ILISEMNYANGPYNTNTRTIPASVVSSYNFIH

Enzyme Prediction     

No EC number prediction in MGYG000001080_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	29	70	4.8e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	3.58e-39	157	272	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK08581	PRK08581	1.33e-22	168	271	508	616	amidase domain-containing protein.
pfam05257	CHAP	3.54e-17	166	247	3	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
PRK10783	mltD	2.39e-16	9	130	321	444	membrane-bound lytic murein transglycosylase D; Provisional
pfam01476	LysM	5.24e-15	29	70	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV86632.1	2.86e-179	1	272	1	272
QTK09978.1	3.81e-168	1	272	1	272
QTK12161.1	3.81e-168	1	272	1	272
QTK07810.1	3.81e-168	1	272	1	272
QUX19658.1	1.09e-167	1	272	1	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	1.66e-37	159	272	43	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	1.48e-36	166	272	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	8.50e-14	168	271	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	8.03e-07	91	133	5	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
2MKX_A	5.22e-06	90	136	6	52	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	3.37e-117	1	272	1	265	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q5HRU2	2.14e-74	1	272	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	2.14e-74	1	272	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q49UX4	3.01e-72	1	272	1	327	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q2FJH7	5.23e-72	1	272	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain USA300) OX=367830 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000418	0.998650	0.000218	0.000253	0.000242	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001080_00652.