CAZyme Information: MGYG000001081_01505

Basic Information

• Species: Acutalibacter sp900755895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900755895
• CAZyme ID: MGYG000001081_01505
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		88322.59	4.5854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001081	3715652	MAG	Sweden	Europe

• Gene Location: Start: 53881; End: 56295 Strand: +

Full Sequence      

MDINKIPQELRDQIPQEFLDQLAQETQKPVFGEKTYEEHLPALCRQAAAEGAVLLKNDNN
VLPLKSGKPVAVFGRVQLDWFYVGYGSGGDVNPPYQINLMEGLQNAGVPVDRELSETYAA
WCGENEPYMGFWGHWPRYFDEMPLTDDQVKSAATRCKTALVVIGRAAGEARENDLEPGSY
YLTEDEKKLLAQVSSSFEKTAVLIDAGSVLDLSWLGDYPISGALFVWQGGMESGNAVADL
LTGKVTPSGKLSDTVALRYEDYPSQNFLGEEYNQYTEDIYVGYRYFETFQKDAVQFPFGF
GLSYTTFALEDVQVKALGDTVRVKVTVKNTGSCDGKEVAQVYACAPQGSLGKASRVLCAF
QKTKLLQPGQSQALTITFPVTAMASFDDSGATGHKNAWVLEPGDYGIFVGTDVRSAQQAD
SVNLPQLRVVAQLQEVCAPVVQFDRLVNRDGEKAWEPVPQAERSLKERILDNLPTEIPYT
GDRGIKLKDVESGLASMEDFVAQLSPEELEALTHGDFIMDSPLGAKGNAAVMGGILESLR
EKGVPPITTTDGPSGIRLQYYCSLLPCGTCLACTWDPALVESLYQAHGREMVQKGSDVLL
GPGMNIHRNPLCGRNFEYFSEDPLLTGKTAGAMVRGIQKNGVSACPKHFACNNQETNREY
NDSQVSQRALREIYLKGFEICVKEAAPHHIMTSYNKINGVWSHYNYDLCTTVLRGEWNYG
GSVMTDWWERPSADPDFPDLWDSAYRVRAQVDVLMPGGSDRAGTPDPAVLESYRKGGLTL
AELQRGAKNVLGAILGSPALAKMD

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	541	756	9.5e-65	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.52e-54	490	794	3	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.62e-41	52	283	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	2.96e-37	45	419	388	760	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	8.98e-25	543	727	65	255	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	5.10e-19	337	412	1	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS42860.1	1.84e-314	33	792	33	803
AQX17210.1	2.61e-314	33	791	19	792
VEP40216.1	3.98e-314	33	791	31	804
APZ35313.1	5.27e-313	33	795	33	825
SCY66942.1	3.97e-311	33	795	33	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	8.03e-239	45	802	41	827	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	8.73e-71	46	428	330	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	8.73e-71	46	428	330	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	3.89e-48	543	794	36	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.15e-44	536	727	29	233	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	3.34e-209	49	802	18	770	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	4.13e-158	37	728	26	771	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P14002	2.13e-47	543	794	36	286	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	9.67e-47	536	804	29	295	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BFG8	1.84e-46	541	791	40	283	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001081_01505.