CAZyme Information: MGYG000001082_00333

Basic Information

• Species: Ruminococcus_E sp900755995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp900755995
• CAZyme ID: MGYG000001082_00333
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		63865.26	4.565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001082	2310000	MAG	Sweden	Europe

• Gene Location: Start: 4460; End: 6244 Strand: -

Full Sequence      

MKKFKQTVSIALSAMMLAGCAATALTANASTGNLCSKYATNPNGKTGMQKTITIDGDASD
WSEDMLIAQGAAWDVANHYKGGHENCVLDTYALFATWDNDNLYVGWQMVNTTDTWARSGD
GPLSDGGRVLDVPLILALSVDPSSTSMSNKNSEGGPIWGNKMGLKFEQHVDHLLYMSGKV
GNGDPAIFTAVDSQGNTDYTTGCKLFKSAGIEYKMATTNICSSIWGLNFSDSISDVYSDS
ADWVDYKSFTGSAGKHDTQYDSFYEIKIPLSVLGIDKNYIESNGIGAMLVATRGESALDC
VPFDDTMLDNATGDYGSDPSTSHEKDDEDVITSPLARIGKGGTVTPTQPTRPTTPTQPTT
SIQPTQGTTQSQDAKVNVTSNIFTGSTTYKGSNSFTVNFNIKSSMKVANGQWELTYDPNY
LEIANPDSLTPYITDGGMINQKTGAVYGVFSDVMNMYDFTSKKPMVSVTFNVKKKIDKNV
DVKLELQELSLGSKSSGKTNYVTVVKNGTYQSSASVSKPEFTINLTELGNVKYGDVNLDG
KVSITDVTVLQNYLAKKSTLSSAALKNADANKDGIVDIIDATDIQCYLAGYITL

Enzyme Prediction     

No EC number prediction in MGYG000001082_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	38	337	1.9e-74	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	2.22e-16	533	589	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	3.54e-11	534	581	1	48	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	4.63e-09	534	589	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14254	Dockerin_II	5.19e-06	534	580	1	45	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd14252	Dockerin_like	2.78e-05	534	588	1	56	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07491.1	4.57e-167	37	350	224	537
AWX97480.1	5.04e-146	38	348	763	1070
AWX95531.1	5.04e-146	38	348	763	1070
QZS61962.1	1.50e-140	65	348	1	284
CDM67953.1	3.06e-66	32	349	772	1094

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.211267	0.788217	0.000122	0.000109	0.000083

TMHMM  Annotations     

start	end
7	29