CAZyme Information: MGYG000001082_02162

Basic Information

• Species: Ruminococcus_E sp900755995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp900755995
• CAZyme ID: MGYG000001082_02162
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		80345.29	4.2363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001082	2310000	MAG	Sweden	Europe

• Gene Location: Start: 6072; End: 8288 Strand: -

Full Sequence      

MKKCRKYISLLLCAAIIMSAFAVTAISAAAAAAAGDSEVYFDNSVFNWDKVYIYAYGTKE
NAKWPGQLMSTTDNGLYKATFSSAYKSENIIFNNGLEEDEGKEQYPSANGLSLKSGQCRL
LTAEKQWVSYGKPDEHGYGIAYTASGTTFSDESMQVKLGLKNAAIGFYSVDGSPKTSFTN
GTVIEIGKGKIGNSTVTLELTATGSDGVETTQTFEYTKTFTAQETTFSSDSDGHTTAAEG
GYYGTNPNMQLGKYKTISVDGDVSDWDSSMIIAQGAANDDPRVYMPSSMHEQPWDGYALY
GAWDDDNLYFMWEMANTTYITSPSDNFAASQEARPWRNSIPMYIALSIDPNKQATGKAVG
TNEDGSTYTNPFVWGCDSGYAKDGGVGFTTHIDTLVTFDSNNSNGGASIYKADVQDTDGT
YMFNYDTRVPIGVRSFEAQDNQNGFKIKYANGTKSETLYGIKDAKGGRTLGDHTDPNANW
VDFYKLGYKKSYGFIYEVAIPYSALGIDRNYVETKGIGAMQILTYGTSGMDTLPHDPSML
DVADVEYSYDPSSSHEKEDIDNITVPLARLGKLLPDTQVNEAEFEVNFGADKNSGQAVGT
DILLTAEPYNNHGDVTYQFMVNGQTVQNSATNTYSFTPNEAGAYTFAVKAVDSDGHTAEV
TKNFYVSDKSEETVIKGDTNRNGVVDVNDVTYLQIHIANGEGSTLIDITNKAWFDAADME
NDGKLDVLDATALQIYLA

Enzyme Prediction     

No EC number prediction in MGYG000001082_02162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	243	569	9.9e-130	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16738	CBM26	3.76e-11	39	109	1	68	Starch-binding module 26. CBM26 is a carbohydrate-binding module that binds starch.
cd14256	Dockerin_I	2.50e-08	676	738	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
PRK14081	PRK14081	2.40e-05	587	674	293	385	triple tyrosine motif-containing protein; Provisional
pfam00404	Dockerin_1	4.72e-04	677	737	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam07495	Y_Y_Y	0.001	609	666	2	64	Y_Y_Y domain. This domain is mostly found at the end of the beta propellers (pfam07494) in a family of two component regulators. However they are also found tandemly repeated in CTC_02402 without other signal conduction domains being present. It's named after the conserved tyrosines found in the alignment. The exact function is not known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT06902.1	0.0	1	697	1	693
CDM67953.1	1.48e-107	48	657	583	1172
AWX97480.1	9.12e-86	36	705	551	1191
AWX95531.1	9.12e-86	36	705	551	1191
QCT07491.1	1.36e-72	1	573	1	528

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.049103	0.936059	0.013168	0.000821	0.000422	0.000397

TMHMM  Annotations     

start	end
7	29